KEGG   Leminorella richardii: NCTC12151_01593Help
Entry
NCTC12151_01593   CDS       T05503                                 

Gene name
cobQ
Definition
(GenBank) Cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
lri  Leminorella richardii
Pathway
lri00860  Porphyrin and chlorophyll metabolism
lri01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lri00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NCTC12151_01593 (cobQ)
Enzymes [BR:lri01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     NCTC12151_01593 (cobQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 AAA_26 CbiA GATase Peptidase_S51
Motif
Other DBs
NCBI-ProteinID: SQI40224
UniProt: A0A2X4XU36
Position
1:1660368..1661915
Genome map
AA seq 515 aa AA seqDB search
MSLSIMLQGTASDVGKSVLTAGLCRIFRQDGRRVAPFKSQNMALNSGIAADGAEMGRAQI
FQAEAAGIAPDVRMNPILLKPTSDCRAQVVLMGKPLSDMEAQHYHQHKPRLLETVERAYR
SLANDFDTIVIEGAGSPAEINLREGDLVNMGLAERIDAPVILVADIDRGGVFAAIYGTLA
LLPQEERDRIKGVIINKFRGDIALLAPGIDMIEKLTNVPVLGVMPFMTLELEDEDSVGLS
QNKYRRERFARGDALDIAVLHLPYMSNFTDFNALAAQPDVCLRYVMRGESIGHPDLLIIP
GSKNTVGDLQALHDSGLANEIRRLSALGTPIMGICGGYQMLGNEIVDGVESGIARCEGLG
LLPVNTRFYPHKTTTQASAKVNTPEGEGLFSALDGVNVTGYEIHMGQTTLNAPLASFCRL
LFRNGEAVDEADGAISEDGNVMGSYLHGLFDEGPFARTLLNRLRQRKGLDPLEQDSGFKA
FKEREYNRLAAQMRASIDIDRVYRIMQQHHGEQSQ
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgtccttatccatcatgctacagggaacggcgtcagacgtcggaaaaagcgtcctgact
gctgggctgtgccgcatatttcgacaggatggccgccgcgtcgcgccgtttaaatcacaa
aatatggctcttaactcgggtatcgcagctgacggtgcagagatggggcgtgcgcaaatc
tttcaggctgaagcagcgggcattgcccccgacgttcgcatgaatcccattttgctgaag
ccgaccagcgactgccgagcgcaggttgtcctgatggggaaaccccttagcgatatggag
gctcagcactaccatcagcataagcctcgtctgctggaaaccgttgagcgcgcttaccga
agcctagcgaacgacttcgatacgatagttattgagggggcgggtagtccggcggaaatt
aatctgcgtgaaggtgacctggtcaatatggggctcgcggagcgcattgatgcgccggtg
attctcgtggctgatatcgatcgcggcggcgtttttgccgcaatttatggcacgctggcg
ctgttgccgcaggaagaaagggatcggataaaaggcgtcatcatcaataagttcaggggc
gatatcgcgctactggcgcccggcattgacatgatagagaaactgacgaatgtgccggtg
ctgggcgtgatgccctttatgacgcttgagctagaagatgaagacagcgttggccttagc
caaaataaataccggcgcgaacgctttgccagaggcgacgcgttggatattgccgttttg
catctgccgtacatgtctaactttaccgattttaacgcgctggccgctcaaccagacgtt
tgcctgcgctatgtgatgcggggtgaatcaataggccatccggatctgctgattattccc
ggcagtaaaaataccgttggtgacttgcaggcgcttcatgacagcggattggcgaatgaa
attcgccggctttctgctcttggcacgccgataatgggtatttgcggtggctaccaaatg
ttggggaacgagattgttgacggcgttgagtctggcattgcgcgctgcgaagggctcggg
ctgttgccggtgaatacgcggttctacccgcataaaaccaccacgcaggcgtcggcgaag
gtcaacacgcctgagggggaagggctcttttctgcgcttgatggggttaacgtcacgggg
tacgaaatccacatggggcaaacgacgctgaacgcgccgctggcgtccttttgtcgtctg
ctgtttcgtaacggtgaagcggttgacgaagccgacggtgcaatcagcgaggacggtaac
gtgatgggcagttatcttcacggcctgtttgatgaagggccgtttgccagaaccctgctg
aacaggcttcgccagcgtaaggggctggatcctctggaacaggacagcggctttaaggct
tttaaagagcgtgaatacaataggctagcggcgcagatgcgcgccagtatcgatattgat
cgggtctatcgcattatgcagcagcatcacggagaacagtcgcaatga

DBGET integrated database retrieval system