KEGG   Leminorella richardii: NCTC12151_01715Help
Entry
NCTC12151_01715   CDS       T05503                                 

Gene name
ltaE
Definition
(GenBank) Low specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
lri  Leminorella richardii
Pathway
lri00260  Glycine, serine and threonine metabolism
lri01100  Metabolic pathways
lri01110  Biosynthesis of secondary metabolites
lri01120  Microbial metabolism in diverse environments
lri01130  Biosynthesis of antibiotics
lri01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lri00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NCTC12151_01715 (ltaE)
Enzymes [BR:lri01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     NCTC12151_01715 (ltaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: SQI40748
UniProt: A0A2X4UY70
Position
1:complement(1795666..1796727)
Genome map
AA seq 353 aa AA seqDB search
MIDLRSDTVTRPSQAMRQAMAGAEVGDDVYGDDPSVNQLEQEAAVMSGKESALFLPTGTQ
ANLVALLSHCQRGEEYIVGQKAHNYMFEAGGAAVLGSIQPQPIDAAPDGTLPLDLVASVI
KPDDIHFAQTRLLCLENTHNGKALPLDYLQQAWAFTRTKKLALHVDGARIFNAAVAMNVP
LSTLTQYCDTLTICLSKGLGAPVGSLLCGSADYIKRARRWRKMTGGGMRQAGILAQGALY
ALHHNVKRLREDHENAQWLAQQLGDMGIEIMEPGAQTNMLFIRLPVNEANQLGPWMKQRG
VLINAGPVTRLVTHLDVSREDLQRVVDLWGEFKSLISVRSQNGQNASRGIYEG
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatttacgcagcgataccgtaacccgccccagtcaggccatgcgacaggccatg
gcaggcgccgaagtgggcgacgacgtctacggtgacgatcccagcgttaaccagctagag
caagaggctgcggtgatgtcgggaaaagagtctgcgctgtttttacctaccggcacacag
gctaacctcgttgcgctgctcagccactgccagcgcggggaagagtatattgtcgggcag
aaggcccataactatatgtttgaggccggaggcgcagccgttctcggcagtattcaacca
cagccgatagatgcagctcctgacggtacgctaccgttagatctcgtcgccagcgtcatc
aagccggatgacattcactttgcacaaacccgcctgctctgtctggaaaacacacacaat
ggtaaagcgctgccgctggactaccttcagcaagcctgggcctttacgcgcacgaaaaag
ctggcgctgcacgttgacggcgcgcgcatttttaacgctgcggttgcgatgaatgttccc
ctcagcacgcttacccaatactgcgatacactgacgatttgtctgtctaaagggcttggc
gccccggtcggttcactgctatgcggcagcgctgactacattaagcgagcccgccgctgg
agaaaaatgaccggtgggggcatgcgtcaagcgggtattttggcgcagggagccctgtat
gcattacatcataacgttaagcggctgcgggaagatcacgaaaacgcccagtggctcgct
cagcagcttggggacatgggcattgagattatggagcccggtgcgcaaaccaacatgctg
tttatccgcctccccgttaacgaggctaaccagcttggcccttggatgaagcagcgcggt
gtgttgattaatgcaggcccggtcactcggctggttactcaccttgacgtatccagagag
gatcttcagcgcgtagtcgatctttggggagaatttaaaagcctgatttctgttcgcagc
cagaacggacagaatgcgtccagaggaatttacgaggggtaa

DBGET integrated database retrieval system