KEGG   Lactobacillus rhamnosus Lc 705: LC705_00225Help
Entry
LC705_00225       CDS       T00990                                 

Definition
(GenBank) Hydrolase of the HAD superfamily
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
lrl  Lactobacillus rhamnosus Lc 705
Pathway
lrl00361  Chlorocyclohexane and chlorobenzene degradation
lrl00625  Chloroalkane and chloroalkene degradation
lrl01100  Metabolic pathways
lrl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lrl00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LC705_00225
   00361 Chlorocyclohexane and chlorobenzene degradation
    LC705_00225
Enzymes [BR:lrl01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     LC705_00225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase HAD_2 HAD Hydrolase_6 5_nucleotid
Motif
Other DBs
NCBI-ProteinID: CAR89064
Position
complement(228621..229277)
Genome map
AA seq 218 aa AA seqDB search
MDITFDCYGTLLDTRPIRTQFMTFSARHGIDGQAAWHQFESWEDRLMYGETTLPFTTLLK
RDLQYLDMTFRTNSLFSHYFHDLFESYINLQPWPEVIPALQQLRQAGHRIIIMSNSTPDL
MTHHFDQLEHQVDQAILPEQTHCYKPTLSFFTTAETRLNQPHLHVAMGYWWDIVPCHKLG
WPCVWINRQQLSPLPDITPTYSLPNLTELPALVEKIAS
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggatattacatttgactgctatggtactttgctagacacccgccccattcgaacccag
tttatgaccttcagtgctcgtcatggtattgacggtcaggctgcatggcaccaattcgaa
tcgtgggaggatcgcctcatgtatggcgagaccaccttgcctttcaccaccttattgaag
cgcgatctgcaatatcttgatatgacttttcgcaccaattcactatttagccattatttt
catgatttatttgagtcctatattaacttacaaccatggccagaagtcatccccgctttg
cagcaattgcgccaagccggtcatcgaatcatcatcatgtccaattccaccccggattta
atgacccaccactttgaccagctggagcaccaagttgatcaagccattttaccggagcaa
acgcattgttataaaccaactttgtccttttttaccacggccgaaacccgactcaaccaa
ccccatctccacgtggcaatggggtattggtgggatatcgtaccctgtcataaactcggc
tggccttgcgtatggattaatcgccagcaattatcaccactaccagacataacgccgact
tattccctgccaaatctgacagaactacccgcgttggtcgaaaaaattgcttcttga

DBGET integrated database retrieval system