KEGG   Lactobacillus rhamnosus Lc 705: LC705_00408Help
Entry
LC705_00408       CDS       T00990                                 

Gene name
sorA
Definition
(GenBank) PTS system, sorbose-specific IIA component
  KO
K02812  PTS system, sorbose-specific IIA component [EC:2.7.1.206]
Organism
lrl  Lactobacillus rhamnosus Lc 705
Pathway
lrl00051  Fructose and mannose metabolism
lrl01100  Metabolic pathways
lrl02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:lrl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    LC705_00408 (sorA)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    LC705_00408 (sorA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lrl02000]
    LC705_00408 (sorA)
Enzymes [BR:lrl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.206  protein-Npi-phosphohistidine---L-sorbose phosphotransferase
     LC705_00408 (sorA)
Transporters [BR:lrl02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Sorbose-specific II component
    LC705_00408 (sorA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EIIA-man
Motif
Other DBs
NCBI-ProteinID: CAR89247
Position
410950..411366
Genome map
AA seq 138 aa AA seqDB search
MEIILVGHAHTAKAFKEAVEMIYGEVPNFHPIDFTPKEGLQSLTNKIISAIDPKKASSTL
IITDLFSGTPYNAAAELVLKKKAADVVAGMCLPMLLEVAVNANSMDVGQLVSHLMKSKEE
FSTSLSEKLTANAKEDDF
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atggaaataattttagttgggcatgcacatactgcaaaagcctttaaagaagcagtggag
atgatttatggtgaggtgccaaatttccatccaatagactttacacctaaagagggtttg
caatcgttgacgaataaaattatttcagcgattgatcctaaaaaagcgtctagtacttta
attattaccgatttattttcaggaacaccttacaatgcagcagcagaattagttttgaaa
aagaaagcggccgatgttgtcgctggaatgtgcttgcccatgttattggaggttgcagtt
aacgcaaatagtatggatgttggtcaactagtatcacatttaatgaagagcaaagaagaa
ttctcaacgagccttagcgaaaaattgacagcaaatgcaaaggaggatgatttctga

DBGET integrated database retrieval system