KEGG   Lactobacillus rhamnosus Lc 705: LC705_00454Help
Entry
LC705_00454       CDS       T00990                                 

Definition
(GenBank) Conserved protein
  KO
K09988  D-lyxose ketol-isomerase [EC:5.3.1.15]
Organism
lrl  Lactobacillus rhamnosus Lc 705
Pathway
lrl00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:lrl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LC705_00454
Enzymes [BR:lrl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.15  D-lyxose ketol-isomerase
     LC705_00454
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyx_isomer Cupin_2
Motif
Other DBs
NCBI-ProteinID: CAR89293
Position
457676..458356
Genome map
AA seq 226 aa AA seqDB search
MKRSRINQILKESERFLRQRQVVLPPFGQWQPADWGDLDTSYAEIKDNMLGWDVTDFGTG
DFDKYGLVAFTFRNGNYAEPEKYPKPYCEKVLLLNEGQELPYHFHRLKEEDTINRGGNLQ
ITVWHSTEDEGLDRTTPVELVKDGHKLVLDPGTVVTLHPGESLTTTTGIYHKWEVEPGTG
EVLVWEVSSTNDDNIDNRFLRDTPRVPEIEEDEEPYRLLFGDYRKL
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgatcaaggatcaatcagattttaaaggaaagcgaaagattcctcaggcagcgt
caagttgttcttcccccttttggtcagtggcaaccagctgactggggagatctggatact
tcttatgcagaaatcaaggataatatgcttgggtgggatgtcacggatttcggaaccggt
gatttcgacaaatacggcttggttgcttttacatttagaaatggcaactatgcggaacca
gaaaagtatccgaagccttattgcgaaaaagtcttgttgttgaatgaaggtcaggagtta
ccttatcattttcatcgactgaaagaggaagatacaatcaaccgcggcggcaatttgcaa
atcacggtgtggcattcaactgaggatgaaggattggatcgcacaacgccggtagaattg
gttaaagatggtcacaagcttgtcttggatcctggtacagtggtgacgctccatccagga
gaaagcctgacaacaacaacaggtatttaccataagtgggaagtagagcccggcacaggt
gaagtcttggtttgggaagtctcctctacgaatgatgacaacatcgacaatcgattttta
cgtgatactccgcgagttcctgaaattgaagaagatgaagagccgtatcggttgttgttc
ggagattatcgaaaattgtag

DBGET integrated database retrieval system