KEGG   Lactobacillus rhamnosus Lc 705: LC705_01412Help
Entry
LC705_01412       CDS       T00990                                 

Definition
(GenBank) Thymidylate synthase
Organism
lrl  Lactobacillus rhamnosus Lc 705
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thymidylat_synt
Motif
Other DBs
NCBI-ProteinID: CAR90251
Position
1407561..1407734
Genome map
AA seq 57 aa AA seqDB search
MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFGHQMRFDLSKGFPLLTTKKVTIRPY
NT seq 174 nt NT seq  +upstreamnt  +downstreamnt
atgttagaacagccatatcttgatcttgcaaaaaaagttctggatgaaggccatttcaag
cctgatcggacccatacaggaacttacagtattttcggccaccaaatgcgtttcgacctt
agcaagggctttccattactgacgaccaaaaaagtaaccattcggccttattaa

DBGET integrated database retrieval system