KEGG   Lactobacillus rhamnosus Lc 705: LC705_01688Help
Entry
LC705_01688       CDS       T00990                                 

Gene name
gki
Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
lrl  Lactobacillus rhamnosus Lc 705
Pathway
lrl00010  Glycolysis / Gluconeogenesis
lrl00052  Galactose metabolism
lrl00500  Starch and sucrose metabolism
lrl00520  Amino sugar and nucleotide sugar metabolism
lrl00521  Streptomycin biosynthesis
lrl01100  Metabolic pathways
lrl01110  Biosynthesis of secondary metabolites
lrl01120  Microbial metabolism in diverse environments
lrl01130  Biosynthesis of antibiotics
lrl01200  Carbon metabolism
Module
lrl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lrl_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lrl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LC705_01688 (gki)
   00052 Galactose metabolism
    LC705_01688 (gki)
   00500 Starch and sucrose metabolism
    LC705_01688 (gki)
   00520 Amino sugar and nucleotide sugar metabolism
    LC705_01688 (gki)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LC705_01688 (gki)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    LC705_01688 (gki)
Enzymes [BR:lrl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LC705_01688 (gki)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FtsA
Motif
Other DBs
NCBI-ProteinID: CAR90527
Position
complement(1703201..1704163)
Genome map
AA seq 320 aa AA seqDB search
MNDQKLIGVDLGGTTVKFAILTQGGEIQQRWSIDTNILDEGSHILPDIVTSINEHLDLYK
MTPADFVGIGMGSPGSVDSEAGTIIGAYNLNWKTLQQARKVIESGTGIPFSVDNDANVAA
LGERWKGAGENDPDVTFVTLGTGVGGGIIANGELLHGVAGSCGELGHVTVDPVNGYLCTC
GKRGCLETVASATGVVRVARDMAEEFAGDSKLKETLDDGDEISSKIVFDLAKEGDRLALM
IVDRVSFYLGLALANVGNLLNPKFIVIGGGVSAAGEFLLTRVDKYFKENTFPNVRETTSL
RLATLGNTAGVIGAASLALK
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaccaaaaattgattggcgtcgacttaggcgggacgaccgtaaaatttgccatt
ttaacgcagggtggcgagattcaacaaaggtggagtattgacaccaacattttggatgaa
ggcagccatattttaccggacattgttacatctattaacgaacatctggatttatacaag
atgaccccggctgattttgtcggcattggcatgggttcgcctggatcggtggacagtgag
gcgggcacaatcatcggtgcttacaacctaaattggaaaaccttgcagcaagccagaaaa
gtaatcgaatcagggaccggcattccgtttagcgtggataatgacgccaatgttgcggcg
ttaggtgagcgctggaaaggcgccggtgaaaacgatcctgatgtcacgtttgtcacgctg
ggtaccggtgttggcggcgggattattgccaatggcgagcttttgcacggtgttgccggt
tcctgtggtgagctaggccatgtcaccgttgatccggttaatggctatctttgcacctgt
ggtaaacgcggttgccttgaaacagttgccagtgcgaccggcgtagttcgggttgcacgt
gacatggcagaagaatttgccggtgactctaagttaaaagaaaccttggacgatggcgat
gagatttcgagcaaaattgttttcgacttggccaaggaaggcgatcgtctggcgttgatg
attgtggatcgggtttctttttacctcggtttggctttggccaatgtcggcaatcttttg
aatccgaaattcatcgttatcggcggcggtgtctccgcggcgggtgaattcttgctgacg
cgagtcgacaagtatttcaaagaaaacaccttcccgaatgttcgtgaaaccaccagtttg
cggttggcgacacttgggaatacagctggcgttatcggtgccgcaagcttggcattgaag
taa

DBGET integrated database retrieval system