KEGG   Lactobacillus rhamnosus Lc 705: LC705_01821Help
Entry
LC705_01821       CDS       T00990                                 

Gene name
mvaA
Definition
(GenBank) Hydroxymethylglutaryl-CoA reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
lrl  Lactobacillus rhamnosus Lc 705
Pathway
lrl00900  Terpenoid backbone biosynthesis
lrl01110  Biosynthesis of secondary metabolites
lrl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lrl00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LC705_01821 (mvaA)
Enzymes [BR:lrl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     LC705_01821 (mvaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: CAR90660
Position
complement(1837109..1838353)
Genome map
AA seq 414 aa AA seqDB search
MKFYEQTPEARRHQLVQEGSLTSTDAALLAAARTLPDATATRLIENAIGEFSLPMGIARN
LMVNGQQHQVPIVNEEPSVVAAASNGARMVAENGGVLAHVGTHEVVAEVVLTDLADLNTA
RQILLAHQATIAAVANAAHPSMVQRGGGFRNLTVTILANRFLKLRLTLNPKAAMGANYAN
TVAEAVADAVTTWVDGTVLASILTNAPSELVTATVKLTPATLATKTLSGDEIAHKIVQLS
DLAFVDPERAVTHNKGILNGVIGAVLATGNDTRAVAASVGAFAAATGQYQPLSRWLMRDG
KLEGYLQMPLPLGAVGGAIGALPLAQAARRLGGYRDLATMQQVIAALGLVQNLAALRALA
GPGIQSGHMKLQANALAIAAGAQDQEVPALVAALRAGEMDLAHAKMYLATIRSK
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgaagttttatgagcaaacgcccgaagctaggcggcaccaacttgtgcaagaagggtca
ttaaccagtacagatgccgctttattggctgcggcacgcacgcttcctgatgctactgcg
actcggttgattgaaaatgcaattggtgaattttccttaccgatgggcattgcgcgaaat
ttaatggtcaatggccagcaacatcaagtaccgattgttaatgaggaaccctctgttgtt
gctgcggccagcaatggtgcgcgaatggtagcggaaaacggcggcgttttagcgcatgtg
ggtacccatgaagtggtggcagaagtggtcttaactgatttagcagatttgaatacggct
agacagatccttttggcccatcaagcaacgatcgcagctgtggccaatgccgcccatccc
tcaatggtgcagcgtggcggaggcttccgcaacctgaccgtgacaatcttggccaaccgg
tttttaaaacttcgcctgacgcttaatcctaaagcggcgatgggcgccaattatgcgaat
acggttgccgaagctgtggcagatgcagtgacaacctgggtggatggaacggttttggcc
agcattttaactaacgcaccgagcgagttagtcacagcaactgtgaaattgacaccggcg
acacttgccacaaaaacactgtcaggggatgaaattgcccataaaattgtgcagctgagc
gatttggcatttgtcgatccagagcgcgcggtgacgcataacaaaggcattcttaacggt
gttattggggcggtcttggcgacgggaaatgacacgcgcgcggttgcggccagtgttggg
gcgtttgccgctgcgactggtcagtatcaaccgttatcacgttggttgatgcgcgatggc
aaacttgaaggctatctgcaaatgccattgccgctgggtgctgtcggaggcgcgatcggt
gcattaccattagcccaggcggcccgccgtcttggaggttatcgcgacttagccaccatg
cagcaggtaattgccgcattaggattagtgcagaatttagcggctttgcgcgcattagcc
ggccccggcattcagtcaggccatatgaaactgcaggccaatgcactggcgattgctgcc
ggagctcaggatcaggaagtacctgctctagtcgccgccttacgcgcaggtgaaatggat
ctggcacatgccaaaatgtatttagcaacgattcgatcaaaatag

DBGET integrated database retrieval system