KEGG   Lactobacillus rhamnosus Lc 705: LC705_01822Help
Entry
LC705_01822       CDS       T00990                                 

Gene name
phbA
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lrl  Lactobacillus rhamnosus Lc 705
Pathway
lrl00071  Fatty acid degradation
lrl00072  Synthesis and degradation of ketone bodies
lrl00280  Valine, leucine and isoleucine degradation
lrl00310  Lysine degradation
lrl00362  Benzoate degradation
lrl00380  Tryptophan metabolism
lrl00620  Pyruvate metabolism
lrl00630  Glyoxylate and dicarboxylate metabolism
lrl00640  Propanoate metabolism
lrl00650  Butanoate metabolism
lrl00900  Terpenoid backbone biosynthesis
lrl01100  Metabolic pathways
lrl01110  Biosynthesis of secondary metabolites
lrl01120  Microbial metabolism in diverse environments
lrl01130  Biosynthesis of antibiotics
lrl01200  Carbon metabolism
lrl01212  Fatty acid metabolism
lrl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lrl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LC705_01822 (phbA)
   00630 Glyoxylate and dicarboxylate metabolism
    LC705_01822 (phbA)
   00640 Propanoate metabolism
    LC705_01822 (phbA)
   00650 Butanoate metabolism
    LC705_01822 (phbA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LC705_01822 (phbA)
   00072 Synthesis and degradation of ketone bodies
    LC705_01822 (phbA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LC705_01822 (phbA)
   00310 Lysine degradation
    LC705_01822 (phbA)
   00380 Tryptophan metabolism
    LC705_01822 (phbA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LC705_01822 (phbA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LC705_01822 (phbA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LC705_01822 (phbA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lrl04147]
    LC705_01822 (phbA)
Enzymes [BR:lrl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LC705_01822 (phbA)
Exosome [BR:lrl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LC705_01822 (phbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: CAR90661
Position
complement(1838366..1839547)
Genome map
AA seq 393 aa AA seqDB search
MEKVVILSAKRTPIGKLGGELAGASAVDLGVTAAKAAIKAARLDPQQLDQAIFGNVLQAG
SGQNVARQIALHSGMATNSTAMTINEVCGSGLKAIRLGQAAIQLGEANAVLVGGTESMSQ
VPYYAEAMRAGHKFGDTALVDGLSRDGLNDAFSQQPMGITAENVASRFQISRQAQDEFAL
RSHLRAAAAAAEGRFKSQIAPVTISGRHGDVTIDTDSAIRPDTSLAQLAKLPPVFEVGGT
VTAGNASGINDGAAALILMAKSKAEQLGLHYLATITDYTEVGIDPDIMGYAPKLAIDQLM
QKTGQTLTAIDQVELNEAFASQSVAVMRDLGLTDEQVNINGGALALGHPLGASGARIMVS
LLYNLAERRQQTGIAALCVGGGIGMAMQVTLHD
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagttgtgattcttagtgccaagcggacgccgattggaaagttgggcggtgag
ttagcaggtgctagtgcagtggatttaggtgttactgcagctaaggcggcgattaaagca
gcacggcttgatccgcaacaactggatcaagcaattttcgggaatgttttgcaggctgga
tcgggccagaatgttgcgcggcagattgcgttgcatagtggcatggcgacgaactccacg
gccatgacgatcaatgaagtttgcggctctgggctaaaggcaattcggttaggtcaggcg
gcgattcaactaggtgaagctaacgcggtacttgtcggcggtaccgagagtatgagtcag
gtaccgtattatgctgaggcaatgcgggccgggcataagtttggcgatactgcgttggtg
gatggtcttagtcgcgatgggctaaacgatgcttttagtcagcaaccgatggggattacg
gcggaaaatgttgccagccgctttcagatcagtcgtcaagcgcaagacgagtttgcactg
cgctctcatctgcgtgcggccgctgctgctgcagaaggccggtttaaatcacaaattgca
ccggtgaccatttccggccgacatggcgatgtcacgattgacacggattcggcgattcga
ccggatacatcattagcccagttagcaaaattaccgccagtttttgaagttggcggtacc
gtcacggcgggtaatgctagcgggattaatgacggggcggctgcattgattcttatggcg
aagtcaaaagccgagcagttaggcctccactatttggctaccatcactgactatacagaa
gtcgggattgacccggacatcatgggttatgcgcctaaattagcgattgaccagctaatg
caaaaaaccggacaaactttaacagccattgatcaagtggaattaaatgaagcattcgcc
tcgcaaagtgttgccgtgatgcgtgacttaggactgactgacgaacaggtgaatatcaat
ggcggagcgcttgctttaggccatcccttgggagcatccggcgcgcggattatggtttca
ttactgtataatctggccgaacgcaggcaacaaaccggtatcgcggcgttatgtgtcggt
ggtggtatcggtatggcgatgcaagttactttgcatgattag

DBGET integrated database retrieval system