KEGG   Lactobacillus ruminis: LRC_02380Help
Entry
LRC_02380         CDS       T01626                                 

Gene name
rluA
Definition
(GenBank) Ribosomal large subunit pseudouridine synthase D
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
lrm  Lactobacillus ruminis
Brite
KEGG Orthology (KO) [BR:lrm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:lrm03009]
    LRC_02380 (rluA)
Enzymes [BR:lrm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     LRC_02380 (rluA)
Ribosome biogenesis [BR:lrm03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    LRC_02380 (rluA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 DUF5420
Motif
Other DBs
NCBI-ProteinID: AEN77560
UniProt: G2SQT6
Position
256740..257654
Genome map
AA seq 304 aa AA seqDB search
MANMEFTWQNHSGKKATVKRILANHGVSHRMIAKLKRGQGNVKLNGEKTVLSALVGQNDK
VTLVLPPENDDERILVSHERIKVVYEDENWLLLDKPAGISSVPGPSNDHDTMMNRVKGYL
IDQKSENLVPHAVTRLDRFTSGLMLCAKHGFAQGLISKQVQEHSMEKRYLAVCSGFVKKD
HGIIDLPLKKEDNGFRRIVSCDGQNAVTEYWVRERFGNEATLVECVLHTGRTHQIRAHFA
HFAHPLISDELYGGKRNDACKRQALHACCLAFDDPFSCKRLRFELPLENDMEHLLGELRC
INCD
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacatggaatttacgtggcagaaccattcggggaaaaaagcaacggtgaaaaga
attctggccaatcatggcgtcagtcatcggatgatcgctaaacttaagcgaggccaaggc
aacgtaaaactgaacggagaaaaaacggttctttcggccttggtcggccaaaatgataaa
gtaacgctcgtgcttccaccggaaaatgacgatgagcggattcttgtcagtcacgaaagg
attaaagtcgtctatgaagatgaaaattggctgttgcttgacaagcctgcaggaatatcc
agcgttcctggtccttcgaacgatcatgatacgatgatgaatcgcgtcaaggggtatctg
attgatcaaaaaagcgaaaatcttgttcctcatgccgtaacaagactggacaggtttaca
agcggactgatgctttgcgcaaagcatgggtttgcgcaaggactgatttcaaagcaggtt
caggaacattcgatggaaaaacggtatttggccgtgtgctctggatttgtcaagaaagat
cacggaattattgacttgccgcttaagaaagaggataacggttttaggcggatcgtttct
tgcgatgggcaaaatgcagtcacggaatattgggttcgagagcgttttggcaacgaagcc
acgttggttgagtgcgttcttcataccggaagaacccatcagattcgtgctcattttgca
cattttgcgcatccgctgatttcagatgaactgtatggaggcaaaagaaacgatgcatgc
aaaagacaagcacttcacgcttgctgtttggcatttgacgatcctttttcctgcaagagg
ctcaggtttgaattgccgcttgaaaatgatatggaacatttgttaggggaattgagatgc
ataaattgtgattga

DBGET integrated database retrieval system