KEGG   Lactobacillus ruminis: LRC_06430Help
Entry
LRC_06430         CDS       T01626                                 

Gene name
tpiA
Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lrm  Lactobacillus ruminis
Pathway
lrm00010  Glycolysis / Gluconeogenesis
lrm00051  Fructose and mannose metabolism
lrm00562  Inositol phosphate metabolism
lrm01100  Metabolic pathways
lrm01110  Biosynthesis of secondary metabolites
lrm01120  Microbial metabolism in diverse environments
lrm01130  Biosynthesis of antibiotics
lrm01200  Carbon metabolism
lrm01230  Biosynthesis of amino acids
Module
lrm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lrm_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lrm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LRC_06430 (tpiA)
   00051 Fructose and mannose metabolism
    LRC_06430 (tpiA)
   00562 Inositol phosphate metabolism
    LRC_06430 (tpiA)
Enzymes [BR:lrm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LRC_06430 (tpiA)
Exosome [BR:lrm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LRC_06430 (tpiA)
  Exosomal proteins of bladder cancer cells
   LRC_06430 (tpiA)
  Exosomal proteins of melanoma cells
   LRC_06430 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEN77937
UniProt: G2SMN9
Position
695943..696698
Genome map
AA seq 251 aa AA seqDB search
MRTPILAGNWKMNMNPEETAEFVKAVKDQLPASSEVESVIAAPAVDLPALLENAKGSELK
VAAENCYFEDKGAFTGETSPKVLKEMGVDYVIIGHSERRDYFHETDEDINKKAKAIFANG
MTPIICCGETLETREAGKAEEWVEGQIKAALEGLTADQVASLVIAYEPIWAIGTGKTATA
DQAEEICAVIRKTVADLYDQTVADKVRIQYGGSVKPANVKELMAKEDIDGGLVGGASLVP
ESYLQLVHFKD
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtacaccaattcttgcaggtaactggaaaatgaacatgaatcctgaagaaacagct
gaattcgtaaaggctgtcaaggatcagttgccagcatcttctgaagttgaatccgttatt
gctgctcctgcagttgaccttcccgcattgcttgaaaatgccaagggatctgaattaaaa
gtagccgctgaaaactgctattttgaagacaagggtgccttcactggcgaaacttctcct
aaagttttgaaggaaatgggcgttgattacgtaatcatcggccactccgaacgtcgtgat
tatttccacgaaacagatgaagacatcaacaagaaggcaaaggcaatctttgccaacggc
atgacgcctatcatctgctgtggcgaaacgttggaaacacgtgaagccggcaaagcagaa
gaatgggtagaaggccaaatcaaggctgccttggaaggattgacggctgaccaagttgcc
agcttggttattgcttatgaaccaatttgggcaatcggtacaggcaagacggctacggct
gatcaagctgaagaaatttgcgcagtaattcgcaagacggttgcagatctttatgatcaa
acggttgcggacaaggttcgcattcaatacggcggttccgtaaagcctgctaacgttaag
gaattgatggctaaagaagacatcgatggcggtcttgtcggtggtgcttcgctcgttcct
gaatcatatttgcaattggttcatttcaaggactaa

DBGET integrated database retrieval system