KEGG   Lactobacillus ruminis: LRC_08160Help
Entry
LRC_08160         CDS       T01626                                 

Gene name
pfk
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lrm  Lactobacillus ruminis
Pathway
lrm00010  Glycolysis / Gluconeogenesis
lrm00030  Pentose phosphate pathway
lrm00051  Fructose and mannose metabolism
lrm00052  Galactose metabolism
lrm00680  Methane metabolism
lrm01100  Metabolic pathways
lrm01110  Biosynthesis of secondary metabolites
lrm01120  Microbial metabolism in diverse environments
lrm01130  Biosynthesis of antibiotics
lrm01200  Carbon metabolism
lrm01230  Biosynthesis of amino acids
lrm03018  RNA degradation
Module
lrm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lrm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LRC_08160 (pfk)
   00030 Pentose phosphate pathway
    LRC_08160 (pfk)
   00051 Fructose and mannose metabolism
    LRC_08160 (pfk)
   00052 Galactose metabolism
    LRC_08160 (pfk)
  Energy metabolism
   00680 Methane metabolism
    LRC_08160 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    LRC_08160 (pfk)
Enzymes [BR:lrm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LRC_08160 (pfk)
Protein phosphatases and associated proteins [BR:lrm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LRC_08160 (pfk)
Messenger RNA biogenesis [BR:lrm03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     LRC_08160 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: AEN78098
UniProt: G2SND5
Position
869109..870071
Genome map
AA seq 320 aa AA seqDB search
MKRIGILTSGGDSSGMNAAVRAIARSAMNAGLEAYGINYGYKGLVEGNIFKMESHQLDGI
IDRGGTILYSARFPEFAEQETQLKGIEQLKKFGIDALVVIGGDGSYHGALKLTKLGFNSI
GVPGTIDNDIPGTDFTIGFDTAVNVATEALDRINDTATSHQRVFVVEVMGRGAGDIALWS
GIAAGADAIVIPERDYDIKAIADKLTANREHGKDHGLVVVAEGVMSAQDFKEKLDQYGEF
DSRAITLGHVQRGGVPTPKDRVLASRFGDYAVRLLLEGKGGLAIGIHDNQLVATDIIDTL
ENHKHQTDVSLADLNDRLSF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcattggtattttgacaagtggcggcgactcatccggtatgaacgctgccgtg
cgtgcaattgcccgttctgcgatgaacgcaggacttgaagcatatggtatcaattatggt
tataaaggccttgttgaagggaatatctttaagatggagtctcatcagcttgacggcatt
atcgaccgtggtggtacgatcctttattctgcacgtttcccagaatttgcagaacaggaa
acgcaattgaaaggtatcgaacaacttaagaagttcggtatcgatgcattggttgttatt
ggcggcgatggctcttatcatggtgctttgaaactgacgaaactcggtttcaactcaatc
ggtgtcccaggtacgattgataatgatattccaggaactgatttcacgatcggttttgat
actgccgttaacgtagccacggaagcacttgatcgtatcaacgacacggcaacgtctcat
caacgcgtgtttgttgtcgaagttatgggtcgtggcgccggtgacattgctctttggtcc
ggaatcgcagccggtgcagatgcaatcgtcatcccagaacgtgactatgatattaaggct
attgctgacaaattgacggctaaccgtgaacatggcaaggatcatggcttggttgtcgtt
gctgaaggcgtaatgtcagcacaagacttcaaggaaaagcttgatcaatacggtgagttt
gacagtcgtgccatcacattgggacacgtacaacgcggcggtgttcctacaccgaaagat
cgcgtattggccagccgtttcggtgactatgccgtacgtttgcttcttgaaggcaagggc
ggccttgctatcggtattcatgacaaccagcttgttgctactgatattatcgacacactt
gaaaaccataagcatcagacagacgtgtcattggcagatctcaatgatcgcttgagcttc
taa

DBGET integrated database retrieval system