KEGG   Lactococcus raffinolactis: CMV25_08675Help
Entry
CMV25_08675       CDS       T05231                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
lrn  Lactococcus raffinolactis
Pathway
lrn00450  Selenocompound metabolism
lrn00970  Aminoacyl-tRNA biosynthesis
lrn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lrn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CMV25_08675
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CMV25_08675
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lrn01007]
    CMV25_08675
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lrn03016]
    CMV25_08675
Enzymes [BR:lrn01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CMV25_08675
Amino acid related enzymes [BR:lrn01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CMV25_08675
Transfer RNA biogenesis [BR:lrn03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CMV25_08675
 Prokaryotic type
   Other AARSs
    CMV25_08675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: ATC61929
UniProt: A0A290PZX2
Position
1744231..1746243
Genome map
AA seq 670 aa AA seqDB search
MTDTNATTSKETFYITTPIYYPSGKLHIGNSYTTIACDVLARYKRLMDFDVFYLTGTDEH
GLKIEQKANELGISPQTYVDGMAADMKKLWATLDISYDKFIRTTDDYHEKAIADMFERLI
AQDDIYLGEYDGWYSVSDEEYFTESQLAEVYRDENGVMIGGKAPSGHEVERVKEESYFFR
MSKYADRLLAYYEAHPDFIQPESRKNEMINNFIKPGLEDLSLSRTTFTWGVPVKSNPKHV
VYVWFDALANYITALGYGSDDTTNFDKFWPANVHMVGKEIVRFHTIYWPIMLMALGLPLP
QQVFGHGWLLMKDGKMSKSKGNVVYPEMLVERYGLDALRYYLMRAVPFGSDGIFTPEDFV
NRVNYDLANDLGNLLNRTVAMINKYQAGDIQTPETQTAFDGTLQAVIETAITNYHASMNK
MEFNVALNEIWTIISRSNKYIDETTPWILAKDASKSGELNSVMYHLAESLRIVAVLLQPF
MRTTSQAIFAQLGLDSAESKLTDLAFGYEFTAPVVSKGEPIFPRLDAEEEVAYIKAQMQA
TSPVAEATEFDPVATTLVSEKKAIKFDDFEKVEIKVAEVIAVEKVEGSDKLLKFELDAGD
EGHRQILSGIAKFYPDPQELVGLKLQIVANLKPRKMMGLLSQGMILSAESDGKLTLLTVA
PEVVNGSIVG
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
ttgactgacactaacgcaacgacttcaaaagaaactttttatattaccacgccgatttac
tatccatctggtaaattacatatcggtaattcttatacaacaattgcttgtgacgtgcta
gcgcgctacaaacgtttaatggattttgacgttttctacctgactgggacagatgagcac
ggcttaaaaatcgaacaaaaagctaatgagcttgggatttcacctcaaacatatgttgac
ggtatggctgccgatatgaaaaaattatgggcaacgcttgatatttcttacgataaattt
attcggacaacggatgattatcatgaaaaagcgattgctgatatgttcgaacgtttgatt
gcccaagatgacatctaccttggtgaatatgatggttggtattcagtttctgatgaagaa
tatttcacagaatctcaacttgctgaagtttatcgtgatgaaaacggtgtgatgattggc
gggaaagcgccaagtggtcacgaggttgagcgtgttaaagaagaatcttatttcttccgg
atgagtaagtacgctgatcgtttgttggcctactatgaagcacatcctgacttcatccaa
cctgaatcacgtaaaaatgagatgattaacaacttcatcaaaccaggtttggaagacttg
tcattgtcacgaacaaccttcacttggggtgtgccggtcaaatcaaatcctaaacacgtc
gtttacgtttggttcgatgcactcgcaaactatatcacagcacttggctatggtagcgat
gatacgacgaatttcgacaaattctggccagccaatgtccacatggtcggcaaagaaatc
gtgcgcttccacaccatttactggccaatcatgttgatggcacttggtttaccattgcct
caacaagttttcggacatggctggttgctcatgaaagacggcaaaatgtctaaatctaaa
ggcaatgtcgtttatccagaaatgttggtagaacgctacggtctcgacgctttgcgttat
tacctcatgcgtgctgtgccgtttggtagtgatggtattttcacaccggaagattttgtt
aaccgtgtcaattatgacttggcaaatgacctagggaatctccttaaccggacggttgct
atgatcaacaagtatcaagcgggtgacatccaaacgccagaaacacagacagcctttgat
ggtacactacaagctgtcattgaaacagccatcacgaactatcatgcgtcaatgaataaa
atggaattcaatgttgcgctcaatgaaatctggacgatcatttcacgttctaacaaatat
attgatgaaacaacaccttggattttagctaaagacgcgagcaaatcaggcgagttaaat
agtgtcatgtatcatttagctgaaagcttacgcatcgttgctgtcttgttgcaacccttc
atgcgcacaacatctcaagccatttttgcacaactaggccttgactcagctgaatcgaaa
ttaacagacttggcatttggttatgaatttacagcaccggttgtcagcaaaggtgagcca
atcttcccacgtttggatgcagaagaagaagttgcttatattaaagcacaaatgcaagcc
acatcaccagtcgccgaagcaaccgaatttgatccagtagcaacgactttagtatctgag
aaaaaagccattaagtttgatgactttgaaaaagttgaaatcaaggttgcggaagtcatt
gctgttgaaaaggttgaagggtcagataaactcttgaaatttgaactggatgcaggcgat
gaaggccaccgtcaaatcttgtctggtattgccaaattctatccagatcctcaagaattg
gtcggcttgaaattgcaaattgtggctaacttgaaaccacggaaaatgatgggcttgctc
tcacaagggatgattttgtcagcagaatctgatggcaaattgaccctcttgacagtagca
ccagaagttgtcaatggtagcattgtaggttaa

DBGET integrated database retrieval system