KEGG   Lactobacillus rhamnosus LOCK900: LOCK900_1369Help
Entry
LOCK900_1369      CDS       T02730                                 

Definition
(GenBank) Dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
lro  Lactobacillus rhamnosus LOCK900
Pathway
lro00670  One carbon pool by folate
lro00790  Folate biosynthesis
lro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lro00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LOCK900_1369
   00670 One carbon pool by folate
    LOCK900_1369
Enzymes [BR:lro01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     LOCK900_1369
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: AGP71178
Position
1316290..1316781
Genome map
AA seq 163 aa AA seqDB search
MTAFLWAQDRDGLIGKDGHLPWHLPDDLHYFRAQTVGKIMVVGRRTYESFPKRPLPERTN
VVLTHQEDYQAPGAVVVHDVAAVFAYAKQHPDQELVIAGGAQVFTAFKDDVDTLLVTRLA
GSFEGDTKMIPLNWDDFTKVSSRTVEDTNPALTHTYEVWQKKA
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcatttttatgggcacaggatcgcgatggcttaattggcaaagatggtcatttg
ccatggcatttacctgatgatttacattatttccgggcgcagacagttggtaagatcatg
gtcgttggccggcgcacctatgaaagttttcctaaacgtcctttacctgagcgaaccaat
gttgttttgacccatcaggaagactatcaagcgccaggtgccgtggtcgtgcatgatgtt
gcggcggtttttgcttatgctaagcagcatcccgatcaggaactggtcattgctggcggt
gcgcaggtctttacagcgtttaaagatgatgtcgatacgttattggtgacacggttggct
ggcagttttgaaggcgacacgaaaatgattccattaaactgggatgattttaccaaagtc
tccagccgcaccgttgaagatactaatccggcgctgacgcacacttatgaggtttggcaa
aagaaggcttaa

DBGET integrated database retrieval system