KEGG   Lactobacillus rhamnosus LOCK900: LOCK900_1488Help
Entry
LOCK900_1488      CDS       T02730                                 

Definition
(GenBank) Glycyl-tRNA synthetase beta chain
  KO
K01879  glycyl-tRNA synthetase beta chain [EC:6.1.1.14]
Organism
lro  Lactobacillus rhamnosus LOCK900
Pathway
lro00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:lro00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LOCK900_1488
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lro01007]
    LOCK900_1488
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lro03016]
    LOCK900_1488
Enzymes [BR:lro01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     LOCK900_1488
Amino acid related enzymes [BR:lro01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   LOCK900_1488
Transfer RNA biogenesis [BR:lro03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    LOCK900_1488
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_synt_2f DALR_1
Motif
Other DBs
NCBI-ProteinID: AGP71296
Position
complement(1446364..1448433)
Genome map
AA seq 689 aa AA seqDB search
MTHDYLIEIGLEDMPAHVVTPSINQFHDKTVAFLKANHLEHGQIDRYATPRRLALLVHDL
AAKQADVETDVKGPAKKIAQDADGNWTKAAIGFSRGQGMTPDDIVFKTIKGVDYVYLHKA
IKGKDAAEILPGMLDVIKSLTFPTRMKWGAYDFEYIRPIHWLVSLLDDTVVPMKLLDVEA
GRVTQGHRFLGKPVTLPNADAYVAALKDQFVIVEPAARKQLIREQIEQIATDHQWQIELD
SDLLEEVNNLVEWPTAFAGTFDPKYLAIPEAVLITSMKDNQRYFYARDQAGKMVNAFIGV
RNGNHDHLNNVIAGNEKVLTARLEDAAFFYAEDQKRSIAEDVERLKAVSFHDKISSMYDK
MARTKVIAALLADQFGLTTDEKADLDRAASIYKFDLVTSMVGEFPELQGIMGEHYARLAG
EKPAVAQAIAEHYEPIAADGALPQSLVGTVLAIADKLDSLMSFFAVDLIPSGSNDPYALR
RQAYGIVRMIAEHDWPFALASLQPTIAKALAAADQTSGLDFAAHQQELNDFMIDRAKQLL
QGQKIRHDIVDAVTVRSDADIAGILDAAKLLTQHAADSDFKPVMEALGRVLRITGKQTVT
TAVDPTKFENPTEGQLHDAVTTTAKTFAAEPTEADYQALKALAKPIDAYFDATMVMADDK
AVRENRLATLQQLAQLIRQFGDVSQVIVK
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgacgcatgactatctgattgaaattggccttgaagacatgccggcccatgttgtcacg
ccaagtattaaccaatttcacgacaaaaccgttgcctttttgaaagccaatcaccttgaa
catggccaaattgaccggtatgcaacgccgcgtcggcttgcgctgctggttcacgattta
gccgctaaacaggcagatgttgaaaccgatgttaaaggcccggccaagaaaatcgctcaa
gatgcggatggtaattggaccaaagctgccatcggattttcccgcggtcaaggaatgaca
ccggatgacatcgtgtttaagacgattaaaggcgttgattatgtttatttgcataaggcg
attaaaggtaaggatgctgccgaaatcttgcctggcatgcttgatgtcattaaaagccta
acgttcccgacgcgaatgaaatggggagcatatgattttgagtacattcgtccgattcat
tggttagtgagtctgctagatgataccgttgtgccgatgaagttattggatgttgaagca
gggcgggtcacccaagggcaccgattcctaggtaagccagtgacgctgcctaatgccgat
gcttatgttgcggcgttgaaagaccagtttgtgattgtagaaccggctgcacgcaaacag
ttgattcgggaacaaatcgagcaaattgccaccgatcatcaatggcagatcgaactcgat
agtgacttattggaagaagttaacaatttagtagaatggccgacagcttttgccggtacg
tttgatccgaaatatctggcaattccggaagcagtgctgattacttcaatgaaagataac
cagcgttacttctatgctcgtgatcaggcaggcaaaatggtcaatgcgtttattggcgtg
cgtaatggcaaccacgatcatttgaacaatgtgattgcgggcaacgaaaaagtgctaacg
gcgcgcttggaagacgcagcattcttctatgccgaagaccagaaacgcagcattgctgaa
gacgttgagcgccttaaagcggttagtttccatgacaaaatcagctcaatgtacgataaa
atggcgcgcaccaaagttattgccgcgttacttgctgatcaattcggtttgaccacagac
gaaaaagctgacctagatcgcgccgcttcgatctacaaattcgatcttgtcacgtcaatg
gtcggtgaatttcctgaattacaagggattatgggcgaacattatgcccggcttgccggc
gaaaaacctgctgttgctcaagcaattgcggaacactacgaaccaatcgcggcagatggc
gccttgccgcaaagtctagtcggcacggtgctggcaattgcggataagctggattcccta
atgagcttctttgccgttgacttaattccaagtggttccaacgatccttatgcgttgcga
cgtcaggcatatggcattgtgcgcatgattgccgaacatgactggccgtttgcgctggct
agcctacagccgaccattgctaaagccttggctgcagctgatcaaacgagcggacttgat
tttgccgcgcaccaacaagaacttaacgatttcatgattgatcgagccaagcagttgttg
caaggtcaaaagattcggcatgatatcgttgatgccgtcactgttcgcagcgatgccgat
attgccggtattttggatgctgctaagctactgacccagcatgcagccgattctgatttc
aagccggtaatggaagccttggggcgggtcttacggattaccggtaagcaaacggtaacg
acagcggttgatccgactaagtttgaaaacccgactgaaggtcaactacatgacgcagtg
acaacaactgccaaaacatttgctgctgaaccgactgaagcggattatcaagcattaaaa
gccttggctaagccgattgatgcctattttgatgcgacgatggtgatggcagatgataag
gccgttcgcgaaaatcgccttgctacattgcagcagcttgcccagttaatccgccagttt
ggtgacgttagccaggtgattgtcaaatag

DBGET integrated database retrieval system