KEGG   Lactobacillus rhamnosus LOCK900: LOCK900_1779Help
Entry
LOCK900_1779      CDS       T02730                                 

Definition
(GenBank) Hydroxymethylglutaryl-CoA synthase
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
lro  Lactobacillus rhamnosus LOCK900
Pathway
lro00072  Synthesis and degradation of ketone bodies
lro00280  Valine, leucine and isoleucine degradation
lro00650  Butanoate metabolism
lro00900  Terpenoid backbone biosynthesis
lro01100  Metabolic pathways
lro01110  Biosynthesis of secondary metabolites
lro01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    LOCK900_1779
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    LOCK900_1779
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LOCK900_1779
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LOCK900_1779
Enzymes [BR:lro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     LOCK900_1779
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG_CoA_synt_N HMG_CoA_synt_C ACP_syn_III Chal_sti_synt_N ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AGP71582
Position
complement(1742930..1744102)
Genome map
AA seq 390 aa AA seqDB search
MKIGIDAIEMDTPDFYVDLVKLAKVRGDDPNKYTIGIGQDEQAVPPSSQDIVILGANAAA
KVLTPASRASLGMILVGTESGVDASKSAALFIHDLLALPEWVRAVELKEACYGGTAALMM
ARDYVASHPDKSVLVIAADIARYGLATAGEVTQGAGAVAMIVKADPRLLTVEPDSVYRSA
SINDFWRPVYQDTALAQGKYSTEQYLAFFKTVWERYQADHHLSAHDFAAMTFHLPYTKMG
KKALDLVLPTTDDASAQRLKNRFEASTRYCRRIGNIYTGSLYLGLLSLLDHDTTLQAGDR
IGLFSYGSGAVAEFFSGILQPQFKEQLHAAEHAQQLTKRQELPVPEYEAVFSDKVPYDAD
DYRPDPAYYRGQFILTGVIGQERHYEKHQS
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcggaattgatgccatcgaaatggataccccggacttttacgtcgatctcgta
aaacttgccaaggttcgcggtgatgatccgaataaatatacgatcggcatcggccaagac
gagcaggcggttccgccatctagtcaagacattgtgatattgggagccaatgccgccgca
aaagtattgacgccagcatcacgtgccagtttaggcatgattctggttggaaccgaaagc
ggggttgatgctagtaaatccgccgccttattcattcatgatcttttggcgctgcctgaa
tgggtgcgggcggttgaactgaaagaagcttgttatggcgggaccgctgcgctgatgatg
gctcgtgattatgttgcgagtcatcctgataaaagtgtgctcgttattgcggcagatatt
gcgcgttatggattagcaacggccggtgaagtgacgcaaggggccggcgcagtggcgatg
attgtcaaagctgatccgcgtctgctgacagttgaaccggattcggtttatcgatcggca
tcaatcaacgacttttggcgaccggtttaccaagatacggcgcttgctcagggaaaatac
tcaaccgaacagtatctcgccttcttcaagacagtctgggaacgttatcaggccgaccat
catttaagcgcacatgatttcgcggcaatgacattccatctgccatataccaaaatgggt
aaaaaagcattggatctagtgttgccaaccaccgatgacgcgagtgcccaacgattgaaa
aaccgttttgaagccagcacgcgttattgtcggcgaattggcaatatttacaccgggtcg
ctttatctggggttgttgtcgttgctggatcatgatacgacattacaagccggggaccgg
atcggactgttttcgtatggttccggtgccgtcgcagagttcttcagcggcattttgcaa
ccacaatttaaggaacaactacacgccgccgaacatgcccagcaactaactaaacgccaa
gaactgcctgtaccggaatacgaagcggtctttagcgataaagtcccgtatgatgccgat
gactatcgccctgatccggcatactatcgtggtcagtttattttgaccggtgtcattggc
caggagcggcactacgaaaaacaccaatcgtga

DBGET integrated database retrieval system