KEGG   Lactobacillus rhamnosus LOCK900: LOCK900_1781Help
Entry
LOCK900_1781      CDS       T02730                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lro  Lactobacillus rhamnosus LOCK900
Pathway
lro00071  Fatty acid degradation
lro00072  Synthesis and degradation of ketone bodies
lro00280  Valine, leucine and isoleucine degradation
lro00310  Lysine degradation
lro00362  Benzoate degradation
lro00380  Tryptophan metabolism
lro00620  Pyruvate metabolism
lro00630  Glyoxylate and dicarboxylate metabolism
lro00640  Propanoate metabolism
lro00650  Butanoate metabolism
lro00900  Terpenoid backbone biosynthesis
lro01100  Metabolic pathways
lro01110  Biosynthesis of secondary metabolites
lro01120  Microbial metabolism in diverse environments
lro01130  Biosynthesis of antibiotics
lro01200  Carbon metabolism
lro01212  Fatty acid metabolism
lro02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LOCK900_1781
   00630 Glyoxylate and dicarboxylate metabolism
    LOCK900_1781
   00640 Propanoate metabolism
    LOCK900_1781
   00650 Butanoate metabolism
    LOCK900_1781
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LOCK900_1781
   00072 Synthesis and degradation of ketone bodies
    LOCK900_1781
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LOCK900_1781
   00310 Lysine degradation
    LOCK900_1781
   00380 Tryptophan metabolism
    LOCK900_1781
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LOCK900_1781
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LOCK900_1781
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LOCK900_1781
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lro04147]
    LOCK900_1781
Enzymes [BR:lro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LOCK900_1781
Exosome [BR:lro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LOCK900_1781
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III YfaZ
Motif
Other DBs
NCBI-ProteinID: AGP71584
Position
complement(1745379..1746560)
Genome map
AA seq 393 aa AA seqDB search
MDKVVILSAKRTPIGKLGGELAGASAVDLGVTAAKAAIKAARLDPQQLDQAIFGNVLQAG
SGQNVARQIALHSGMATNSTAMTINEVCGSGLKAIRLGQAAIQLGEANAVLVGGTESMSQ
VPYYAEAMRAGHKFGDTALVDGLSRDGLNDAFSQQPMGITAENVASRFQISRQAQDEFAL
RSHLRAAAAAAEGRFKSQIAPVTISGRHGDVTIDTDSAIRPDTSLAQLAKLPPVFEVGGT
VTAGNASGINDGAAALILMAKSKAEQLGLHYLATITDYTEVGIDPDIMGYAPKLAIDQLM
QKTGQTLTAIDQVELNEAFASQSVAVMRDLGLTDEQVNINGGALALGHPLGASGARIMVS
LLYNLAERGQQTGVAALCVGGGIGMAMQVTLHD
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggataaagttgtgattcttagtgccaagcggacgccgattggaaagttgggcggtgag
ttagcaggtgctagtgcagtggatttaggtgttactgcagctaaggcggcgattaaagca
gcacggcttgatccgcaacaactggatcaagcaattttcgggaatgttttgcaggctgga
tcgggccagaatgttgcgcggcagattgcgttgcatagtggcatggcgacgaactccacg
gccatgacgatcaatgaggtttgcggctctgggctaaaggcaattcggttaggtcaggcg
gcgattcaactaggtgaagctaacgcggtacttgtcggcggtaccgagagtatgagtcag
gtaccgtattatgctgaggcgatgcgggccgggcataagtttggcgatactgcgttggtg
gatggtcttagtcgcgatgggctaaacgatgcttttagtcaacaaccaatgggaatcacg
gcggaaaatgttgccagtcgctttcagatcagtcgtcaagcgcaagacgagtttgcactg
cgctctcatctgcgtgcggctgctgctgctgcagaaggccggtttaaatcacaaattgca
ccggtgaccatttccggccgacatggcgatgtcacaattgacacggattcggcgattcga
ccggatacatcattagcccagttagcaaaattaccgccagtttttgaagttggcggtacc
gtcacggcgggtaatgctagcgggattaatgatggagcggctgcattgattcttatggcg
aagtcaaaagccgagcagttaggcctccactatttggctaccatcaccgactatacagaa
gtcgggattgacccggacatcatgggttatgcgcctaaattagcgattgaccagctaatg
caaaaaaccggacaaactttaacagccattgatcaagtggaattaaatgaagcattcgcc
tcgcaaagtgttgccgtgatgcgtgacctaggactgactgacgaacaggtgaatatcaat
ggcggagcgcttgctttaggccatcccttgggagcatccggcgcgcggattatggtttcg
ttactgtataatctggccgaacgcgggcaacaaaccggtgtcgcagcgttatgtgtcggt
ggtggtatcggtatggcgatgcaagttactttgcatgattag

DBGET integrated database retrieval system