KEGG   Lactobacillus rhamnosus LOCK900: LOCK900_2879Help
Entry
LOCK900_2879      CDS       T02730                                 

Definition
(GenBank) Mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
lro  Lactobacillus rhamnosus LOCK900
Pathway
lro00051  Fructose and mannose metabolism
lro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    LOCK900_2879
Enzymes [BR:lro01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     LOCK900_2879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UPF0052 UDPG_MGDP_dh_N 3HCDH_N CoatB Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: AGP72654
Position
complement(2842014..2843168)
Genome map
AA seq 384 aa AA seqDB search
MMEAVHFGAGNIGRGFIGETLAANGFKINFVDVNETIINALNQRGEYTITLAAPGEKKIH
VDNVDGLNNAKDPEAVVKAIAQADLVTTAIGPKILPIIAPLIAQGLQARAAANNHQPLDV
IACENMIGGSQSLKKSVYEHLDDAGKTFADTYVGFPNAAVDRIVPQQKHDDPLAVSVEDF
KEWVVDESQMKNHDLKLKTVDYVPDLEPYIERKLFSVNTGHATTAYTGKYLGYSTIGEAI
KDPKVFNQAKGALAETRSLLLAEFKNFDEKELETYQNRVLQRFQNPYISDDISRVARTPI
RKLGYNERFIRPIRELKERGLDYSVLMDTVGMMFHYVEPNDAEAVKLQAMLKDQPLVDVI
KEVTGLKDAALIDEVEASVKSKDR
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgatggaagcagtacattttggtgcaggtaatattggtcgcggctttatcggtgaaacg
cttgccgctaatggattcaaaatcaattttgtcgatgttaacgagacgattatcaatgcg
ttaaatcagcgcggggaatacacgatcactttggccgccccgggtgaaaagaaaattcat
gtggacaatgttgacgggttgaataacgccaaggatcctgaggcagtcgtgaaagctatt
gcccaagccgacttggttacgacggcgattggcccgaagattctccctatcattgcaccg
ctgattgctcaaggtttacaagcacgcgcagccgccaacaaccaccaaccattagatgtg
attgcgtgtgagaacatgattggcggatcacagtcgctgaagaagagcgtttatgaacat
cttgatgacgccggcaagacctttgctgacacgtacgttggcttccctaatgcagcggtt
gatcgcattgtcccgcagcaaaaacatgatgatccattagcagttagtgttgaagacttc
aaagaatgggttgttgacgaaagccagatgaagaaccatgatctgaagcttaagaccgtc
gactatgtacctgatctcgaaccatacattgaacgtaagctcttctcagtcaacactggc
cacgcaaccacggcttataccggcaagtacttgggctacagcacgatcggtgaagccatc
aaggatcctaaagtcttcaatcaggccaaaggtgcacttgccgaaacccgctcactgctt
ttagctgaattcaaaaactttgacgaaaaggaactcgaaacttatcaaaatcgggtcttg
caacggttccagaacccgtatatttccgatgatatttcgcgagttgcccggacgccaatt
cgtaagcttgggtacaacgaacgcttcatccggccgattcgggaactgaaggaacgcggt
ttggattacagcgtcttgatggatacggttggcatgatgtttcattatgttgaacctaat
gatgccgaagccgttaaacttcaggcgatgctcaaggatcagccattagtagacgtcatt
aaagaagtaaccgggttaaaagatgctgctttgattgatgaagttgaagcaagtgttaaa
tccaaggatcgttaa

DBGET integrated database retrieval system