KEGG   Lactobacillus reuteri TD1: N134_00305Help
Entry
N134_00305        CDS       T02745                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lrr  Lactobacillus reuteri TD1
Pathway
lrr00071  Fatty acid degradation
lrr00072  Synthesis and degradation of ketone bodies
lrr00280  Valine, leucine and isoleucine degradation
lrr00310  Lysine degradation
lrr00362  Benzoate degradation
lrr00620  Pyruvate metabolism
lrr00630  Glyoxylate and dicarboxylate metabolism
lrr00640  Propanoate metabolism
lrr00650  Butanoate metabolism
lrr00900  Terpenoid backbone biosynthesis
lrr01100  Metabolic pathways
lrr01110  Biosynthesis of secondary metabolites
lrr01120  Microbial metabolism in diverse environments
lrr01130  Biosynthesis of antibiotics
lrr01200  Carbon metabolism
lrr01212  Fatty acid metabolism
lrr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lrr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    N134_00305
   00630 Glyoxylate and dicarboxylate metabolism
    N134_00305
   00640 Propanoate metabolism
    N134_00305
   00650 Butanoate metabolism
    N134_00305
  09103 Lipid metabolism
   00071 Fatty acid degradation
    N134_00305
   00072 Synthesis and degradation of ketone bodies
    N134_00305
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    N134_00305
   00310 Lysine degradation
    N134_00305
   00380 Tryptophan metabolism
    N134_00305
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    N134_00305
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    N134_00305
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    N134_00305
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lrr04147]
    N134_00305
Enzymes [BR:lrr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     N134_00305
Exosome [BR:lrr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   N134_00305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AGR63553
UniProt: S5N966
Position
69392..70570
Genome map
AA seq 392 aa AA seqDB search
MEKVYIVAAQRTPIGKFNGQLASKSAVELGAIAINAAVEKAKLSGNDIDQVLMGNVIQAG
TGQNPARQASMAAGLGEQVPAITINDVCASGMSSVDLAASLIRAGQANVIVAGGMESMSQ
APYVLPKARNGYRFGNGTLLDAMQSDALNDVYGGYPMGITAENINDKYQITRHQQDEFAL
MSHQHAVKAQKAGYFDSEIVPVEVEQKRTTVTVKVDEAPRPDTSLAALAKLKPAFKSDGS
VTAGNASGINDGGAALVLASESAVNQLGLTPLAEWQGSAVVGLDPALMGLGPYYAIKKLL
KNQQMAADDVDTYEINEAFATQALVCQDLLHLDPSAVNPWGGAIALGHPVGCSGARIIVT
MINKMHWDNHELGIASLCVGGGMGEAVLLKKI
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggagaaggtttacattgttgctgctcagcgaacaccaatcggtaagtttaacggtcag
ttagcttcaaagtctgcagttgaattaggagcgattgcaattaacgcggctgttgaaaag
gcaaagctcagtggaaacgatattgaccaagtattaatggggaatgttattcaagcagga
acgggacaaaatccagctcgccaagcatcgatggccgctggcttaggtgagcaggttccg
gcaataacgattaatgacgtctgtgcgtcgggaatgtccagtgttgacctggcagcaagt
ttgattcgcgcaggacaagctaatgtaattgttgccggggggatggaaagtatgtctcaa
gctccttatgtccttcctaaggcacggaatggctatcggtttgggaacggaaccttactt
gatgcaatgcaaagtgatgctttaaatgacgtttatggcggttatccaatgggaattact
gctgaaaatatcaatgataagtatcagattactcgtcaccaacaagacgaatttgctttg
atgagccaccaacatgcggtaaaagctcaaaaagcaggctatttcgattcagaaattgtg
cccgttgaagttgagcagaaacgaaccactgtaactgtaaaggttgacgaagcaccacga
ccagatacttccctagcggctttagcgaaattaaaaccagcttttaaatctgacggaagt
gtgactgcaggaaatgcctcgggaattaatgatgggggagctgccttagttcttgcttct
gaaagtgcagtcaatcaattaggattaactccattggctgagtggcaaggatctgcagtt
gttggtcttgatccagcattgatgggtctgggaccatattatgcaatcaagaagctctta
aaaaatcagcagatggcggcagatgacgtggatacttacgaaattaatgaagcgtttgcg
acccaagcccttgtctgtcaggacttgcttcatcttgatcctagtgctgtcaatccttgg
ggtggagcaattgcgttaggccatccagttgggtgttcaggcgcgcgaattatcgtcacg
atgattaataaaatgcattgggataatcatgaactcggcattgcttcactgtgtgtcggg
ggcggaatgggtgaagcggttctgcttaagaaaatttag

DBGET integrated database retrieval system