KEGG   Lactobacillus reuteri TD1: N134_01070Help
Entry
N134_01070        CDS       T02745                                 

Definition
(GenBank) 3-hydroxy-3-methylglutaryl-CoA reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
lrr  Lactobacillus reuteri TD1
Pathway
lrr00900  Terpenoid backbone biosynthesis
lrr01110  Biosynthesis of secondary metabolites
lrr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lrr00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    N134_01070
Enzymes [BR:lrr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     N134_01070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: AGR63669
UniProt: S5N9R6
Position
260793..262055
Genome map
AA seq 420 aa AA seqDB search
MTDWQHGFYKLSADDRRQQLTKARQLSPIEEQVLANTSSDLGDELVENYITDYSLPEGVA
LNITVNNRQYVVPMVIEEPSVIAAASNGAHRVSRSGGFNAPQQDRQLVGQVVLDDVTDKA
AVTSWLLKHQDEILTIANQAHPSMQARGGGAKSMKVRTPGDFISVDLGIDVCQAMGANSV
NTMAEAVGKWLTGQGFHVITAILSNLATQSLQTATCKVDFRYLATPEMDGKEVAQRIARL
SDLAQVDPYRAATHNKGIMNGIDAVMIASGNDWRAIESGAHAYAARDGQYRGLSTWEIQD
DYLVGKIVLPLPVGVIGGSIGLNKMTKINYHISQIKSAEELAAVTASIGLAQNLAALRAL
TTTGIQAGHMKLQYRSLAASVGATPAEVPLVVARLKQRSHVDQALAKEILSTIRKDQVND
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgactgattggcaacacggtttttataagttatctgccgatgatcgacgtcaacaattg
acaaaagctcgtcaactatcccccattgaagagcaagtattagcaaatacaagttcagat
ttaggggatgagttagtcgaaaattatattactgattattctttacctgaaggagtagcc
ttaaatataactgtaaataatcgtcagtatgttgtgccgatggtgattgaagaaccatca
gtcattgctgctgctagcaatggtgcgcaccgggtaagcaggtcgggaggatttaatgcc
cctcagcaagaccgccaattagtggggcaagttgttttagacgatgtgaccgataaagca
gcagttacatcatggctattaaaacaccaagatgagattttaacaattgctaaccaggcg
cacccatcaatgcaggcacgaggtgggggtgcaaaatcaatgaaagttcgcactcctggg
gactttattagcgttgatttagggattgatgtttgtcaggcaatgggcgctaatagtgtc
aatacgatggcagaagcagttggaaaatggttaacaggccagggcttccatgttattacc
gcaattttaagcaatcttgcaacgcagagtctgcaaaccgctacttgtaaagttgatttt
cgatacttagcaactccggagatggatggtaaagaggttgctcaacgaattgctcgtctt
agtgatcttgcacaagttgatccttaccgagcagctacccataataagggaataatgaac
ggaatcgatgcggtcatgatcgccagtggaaatgattggcgggcgattgaaagcggagcc
catgcctatgctgctcgtgacggacaatatcgagggttaagtacttgggaaattcaggat
gactatttggtaggaaaaattgttcttcctttaccggttggtgtaattggtggttcaatt
ggtttaaataagatgacaaagataaactatcatattagtcaaattaaaagtgccgaagaa
ttagcagcagtgacagcaagtatcggattagcgcaaaatctggctgctttacgagcattg
acaactaccgggattcaagctggccatatgaaactccaataccgttcgttagcggcaagc
gtcggcgcgaccccagcagaagtgccactagtagtagcacggttaaagcaacgctcacat
gttgatcaagcgcttgctaaagaaatattatcaacgatcagaaaggaccaagttaatgac
tga

DBGET integrated database retrieval system