KEGG   Lactobacillus reuteri TD1: N134_03355Help
Entry
N134_03355        CDS       T02745                                 

Definition
(GenBank) hypothetical protein
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lrr  Lactobacillus reuteri TD1
Pathway
lrr03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:lrr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    N134_03355
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lrr03400]
    N134_03355
Enzymes [BR:lrr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     N134_03355
DNA repair and recombination proteins [BR:lrr03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     N134_03355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 SH3_13 UvrD_C_2 AAA_11 Viral_helicase1 AAA AAA_22 Sigma54_activ_2 T2SSE UvrD-helicase AAA_7 TBPIP RsgA_GTPase AAA_29 DUF815 DEAD TsaE UvrD_C AAA_25 HTH_IclR AAA_14 AAA_16 NB-ARC AAA_18 AAA_12 Zeta_toxin NTPase_1 TIP49 AAA_28 HHH_5 AAA_23 Mg_chelatase AAA_17
Motif
Other DBs
NCBI-ProteinID: AGR64038
UniProt: S5NAH6
Position
720629..723106
Genome map
AA seq 825 aa AA seqDB search
MAEEIDLFKTPTEPSFFIGQVQSEIFTSPDSFFKVLIVSVEEANFDWHEPEITVTGSFGD
LSDDQTYRFEGKIVEHPRYGQQFQATSYHANRPTSKDGLVDFLSGKQFTGIGKKTAKKIV
DKLGTDAINKIIADPHVLDELKLRKAVKDSLVDNLRANQGMDQIIIGLNDLGFGANLSSA
IFDKYGEETLHIINENPYQLAAEIDGISFNRADQVAQKLGIATDDSRRIDAAIIQTLDDL
TMETGDTFTTTKPLLQQTIQLLAQGSGGRVSTDLIANQIVELEKNQAISYADEKIYPTAL
YNAEWQIADHLHRLLTVDQEKVPATTIEKTVTKVADQSGITYDQVQKEAIKTALSSKVML
LTGGPGTGKTTIIKGIVASYAKIHDLSLDVNEYKEKSFPVLLAAPTGRAAKRMSEATDLP
ASTIHRLLGLNGREMPTDMNARDLEGSLLIIDEMSMVDTLLFKTLIQAIPTSMHVVLVGD
KDQLPSVGPGQVFHDLLDFAELPKVELTNIHRQAADSTIIPLAHAIKEGKLPSDLTNKMP
DRSFISCHANQVPSVVQQIIDLSKKRDYSANDIQILAPMYRGQAGIDRLNELAQQAYNPP
ANGKQEVDFRGLTFRVGDKVLQLVNVPEKNIFNGDIGKITAIESGRTVGKKNESITVDFD
GNEVSYSRMEWNQLRLAYCISIHKAQGSQFKMVLLPIVQQFSRMLQRNLLYTAITRAAEK
LVLIGEPYAVVTSVKNEAVNRKTSLVDRLDKVWSRHGELKSKLDHQTDSLAKELSSPQPV
QKENEQLINNDAQQYILTADLINSETIDPLIGMENISLQSLHQAK
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagaaatcgacctatttaagacgccaacggagccgtctttttttattggtcaa
gtacaatctgagattttcactagtccagattcgttttttaaggttttaattgtctcggtt
gaagaagcaaactttgattggcatgagccggaaattaccgtaactggaagttttggtgat
cttagtgatgatcaaacttaccgctttgagggaaaaattgttgaacatccgcgatatgga
caacaatttcaagcgacttcttaccatgccaaccgtccgacaagtaaggatggactagtt
gatttcttgtctggaaaacaatttaccggaattggaaaaaagacggccaaaaaaattgtg
gacaagttaggaacagatgcaattaataaaattattgctgacccgcatgttttagatgaa
ttaaaactccgcaaagcagttaaggattcattagttgataatttacgagcaaaccagggg
atggaccagattattatcggcttaaatgatctcggctttggcgctaaccttagtagtgca
atttttgacaagtacggagaagaaactctgcatattattaatgaaaatccttaccaactc
gctgctgagatagatggaattagctttaatcgggctgatcaggtggcacagaaattagga
atcgccacggatgattcacgtcgaattgatgccgcaattatccagacgcttgatgacttg
acaatggaaactggtgatacatttactacaaccaaacctcttctgcagcaaactatccag
ttgcttgcccaaggaagtgggggccgtgtttcgaccgatttaattgccaaccaaattgtt
gagctagagaaaaatcaagcaattagttatgcggatgaaaaaatttatccaactgccctt
tataacgcggaatggcaaattgctgatcacttacatcgtcttcttaccgttgaccaggaa
aaagtaccagcaacgactattgagaaaacagttacgaaggttgccgatcaatcagggata
acctatgaccaagttcaaaaagaggccatcaaaacagccttaagtagtaaagttatgctt
ctcacgggaggcccaggaacgggaaaaacaacaattattaaagggattgtagcaagttat
gcgaaaattcatgatctttcattggacgtaaatgaatataaagaaaagtcatttcctgtt
ttactagctgctcctacaggccgtgctgctaaacgaatgagtgaagctactgatttacca
gcaagtacaattcaccgcttgctcgggcttaatggccgggaaatgccaactgatatgaat
gcccgcgatttagaaggatcgctattgattattgatgaaatgtcgatggtcgataccctc
ttgtttaagactcttattcaagccatccctacttctatgcatgtagttttggtaggtgat
aaggatcaattgccatctgttggtcccgggcaagttttccatgatcttcttgattttgca
gaactgcccaaagttgaactgaccaatattcaccgccaggctgctgattcaacaattatc
ccattagctcatgctatcaaagagggtaagctaccatcagatctaacgaataaaatgcca
gatcgatcatttatctcatgccatgctaaccaagtgccaagtgtggttcaacaaattatt
gacctttctaaaaaacgagattattcagcaaatgatattcaaatcttggcaccaatgtac
cgcggacaggcaggaatcgaccgtttgaatgaacttgcacaacaggcgtataatcctcca
gctaatggaaaacaagaagtcgattttaggggactaacttttcgtgttggagataaggtt
ctgcaactcgttaatgttccagaaaagaacatttttaatggtgatattggaaaaatcaca
gcaattgaaagcggtaggacagtcggtaagaaaaatgaatcaattactgtcgattttgat
ggtaatgaagtgagttatagccgcatggaatggaatcaattacggttagcttattgtatt
tcgatccataaagcacagggaagtcagtttaagatggttcttttgccgattgttcagcag
tttagccggatgcttcaacgaaatcttttatatacggcgattacccgtgccgcagaaaag
ttagtcttgatcggtgagccgtatgcggttgtgactagtgtaaaaaatgaagcagttaac
cggaaaacttctttggtcgatcggcttgataaggtttggagtaggcatggtgaactaaaa
tcaaaattggatcatcaaacggattcgttagccaaagaactttctagtccgcaacctgtt
caaaaagaaaatgaacagttaataaataatgatgctcagcaatatatcctaacagctgat
ctcattaattcagagacaattgatccattaatcggaatggaaaatattagcttacaaagt
ttgcatcaagccaaataa

DBGET integrated database retrieval system