KEGG   Lactobacillus reuteri TD1: N134_04060Help
Entry
N134_04060        CDS       T02745                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA synthase
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
lrr  Lactobacillus reuteri TD1
Pathway
lrr00072  Synthesis and degradation of ketone bodies
lrr00280  Valine, leucine and isoleucine degradation
lrr00650  Butanoate metabolism
lrr00900  Terpenoid backbone biosynthesis
lrr01100  Metabolic pathways
lrr01110  Biosynthesis of secondary metabolites
lrr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lrr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    N134_04060
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    N134_04060
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    N134_04060
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    N134_04060
Enzymes [BR:lrr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     N134_04060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG_CoA_synt_C HMG_CoA_synt_N Chal_sti_synt_N ACP_syn_III ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AGR64096
UniProt: S5N502
Position
857866..859023
Genome map
AA seq 385 aa AA seqDB search
MRIGIDRMAFATTNDYLDLVELAKERGVDPNKFTIGIGQDLQAVVPPTQDIVTLGATAAK
KLLTPELEKNISTVIVATESGIDNSKASAIYIKHLLGLSDFTRTVEMKEACYSATAAIQF
AKGVVALNPQETVLVIAADIARYGLNTPGEVTQGAGAVAMLISQNPHILTLEDTTVAYSK
DIMDFWRPLYATEALVDGKYSTNVYIEFFLQTFTRYQQLTGRELADFAALTFHMPFTKMG
KKGLEGLLKDRNDKVAQQLRTQLTASQLFSRQVGNLYTGSLYLSLMSLLQNSDLRAGSRI
GLFSYGSGAEGEFYTGILEDGYEHYMNNIQEELKHRHQVSVAEYEKLFSSQLGMNDRDIE
FDVTNDPLPFVLKGQKDHQRIYEAK
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgagaattggtattgacagaatggcttttgcaacaacaaatgattatttagatcttgtt
gaattagcaaaagaacgcggcgtagatcccaataaatttaccattggaattggacaggat
ctacaggcagttgtgccacctacgcaagatattgtaactttaggagctacggcagcgaaa
aaattgcttactccggaattagaaaaaaatatttcgacagtaattgtggcaactgagtca
gggattgacaattcaaaagcaagtgcaatctacattaaacacttattggggcttagcgac
tttacccgaacggtagaaatgaaagaggcttgttattctgcaacagctgctatccaattt
gcaaagggagtagtggcgcttaatcctcaagaaactgtgttggtgatcgctgctgatatt
gctcgttatggattaaatactccaggagaggtgactcaaggagctggagcagttgcaatg
ctgatttcacagaacccgcacatcctaacccttgaagatacaactgtcgcttatagcaag
gatataatggacttttggcggccgttatatgcaacagaagctttagtagatggaaaatac
tctactaatgtttatattgaattcttccttcaaacttttacccgttaccagcaattaact
gggcgagaattagcggattttgctgcccttacgttccatatgccgtttactaaaatggga
aagaaagggttagaagggttgctcaaagatcgtaatgataaggtagcccaacaattacga
acacaattaaccgcaagccagctattttcgcgccaagttggtaacctttacactggctcc
ctatatttatcattaatgtcattgttgcaaaatagtgacttaagagctggaagccgaatt
gggttatttagctatggttctggtgcagaaggggagttctacacaggaatcttagaagat
ggctacgagcattatatgaataatattcaagaagaattaaaacatcgtcaccaggtttcg
gtggcagaatacgaaaaactatttagtagtcaattaggaatgaatgatcgggatatcgag
tttgatgttactaatgatccattgcctttcgttcttaaaggacaaaaggatcatcaacgg
atttatgaagctaaataa

DBGET integrated database retrieval system