KEGG   Lactobacillus reuteri I5007: LRI_0061Help
Entry
LRI_0061          CDS       T02701                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lrt  Lactobacillus reuteri I5007
Pathway
lrt00071  Fatty acid degradation
lrt00072  Synthesis and degradation of ketone bodies
lrt00280  Valine, leucine and isoleucine degradation
lrt00362  Benzoate degradation
lrt00620  Pyruvate metabolism
lrt00630  Glyoxylate and dicarboxylate metabolism
lrt00640  Propanoate metabolism
lrt00650  Butanoate metabolism
lrt00900  Terpenoid backbone biosynthesis
lrt01100  Metabolic pathways
lrt01110  Biosynthesis of secondary metabolites
lrt01120  Microbial metabolism in diverse environments
lrt01130  Biosynthesis of antibiotics
lrt01200  Carbon metabolism
lrt01212  Fatty acid metabolism
lrt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lrt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LRI_0061
   00630 Glyoxylate and dicarboxylate metabolism
    LRI_0061
   00640 Propanoate metabolism
    LRI_0061
   00650 Butanoate metabolism
    LRI_0061
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LRI_0061
   00072 Synthesis and degradation of ketone bodies
    LRI_0061
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LRI_0061
   00310 Lysine degradation
    LRI_0061
   00380 Tryptophan metabolism
    LRI_0061
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LRI_0061
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LRI_0061
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LRI_0061
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lrt04147]
    LRI_0061
Enzymes [BR:lrt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LRI_0061
Exosome [BR:lrt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LRI_0061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C SpoVAD ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AGN98270
UniProt: R9WI59
Position
69468..70646
Genome map
AA seq 392 aa AA seqDB search
MEKVYIVAAQRTPIGKFNGQLASKSAVELGAIAIKAAVEKAKLSGNDIDQVLMGNVIQAG
TGQNPARQASMAAGLGEQVPAITINDVCASGMSSVNLAASLIRAGQANVIVAGGMESMSQ
APYVLPKARNGYRLGNGTLLDAMQSDALNDVYGGYPMGITAENINNKYQITRRQQDEFAL
LSHQRAVKAQKAGYFDSEIVPVEVKQKRTTVTVKVDEAPRPDTSLVALAKLKPAFKSDGS
VTAGNASGINDGGAALVLASESAVNQLGLTPLAEWQGSAVVGLDPALMGLGPYYAINKLL
KNQQMAADDVDTYEINEAFATQALVCQELLHLDPNAVNPWGGAIALGHPVGCSGARIIVT
MINEMHWDNHELGIASLCVGGGMGEAVLLKKI
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggagaaggtttacattgttgctgctcagcgaacaccaatcggtaagtttaacggtcag
ttagcttcaaagtctgcagttgaattaggagcgattgcaattaaagcggctgttgaaaag
gcaaagctcagcggaaacgatattgaccaagtattaatggggaatgttattcaagcagga
acgggacaaaatccagctcgtcaagcgtcaatggccgctggcttaggtgagcaggttccg
gcaataacgattaatgacgtctgtgcgtcgggaatgtccagtgttaacctggcagcaagt
ttaattcgcgcaggacaggctaatgtaattgttgctggggggatggaaagtatgtcccaa
gccccatatgttcttcctaaagcacggaatggttatcggcttgggaacggaaccttactt
gatgcaatgcaaagtgatgctttaaatgacgtttatggcggttatccaatgggaattact
gctgaaaatatcaataataagtatcagattactcgtcgccagcaagacgaatttgctttg
ttgagccatcaacgtgcagtaaaagctcaaaaagcaggctatttcgattcagaaattgtg
cccgttgaagttaagcagaaacgaaccactgtaactgtaaaggttgacgaagcaccacga
ccagatacttccctagtggctttagcaaaattaaaaccagcttttaaatctgacggaagt
gtgactgcaggaaatgcctcgggaattaatgatgggggagctgctttggttcttgcttct
gaaagtgcagtcaatcaattaggattaactccattggctgagtggcaaggatctgcagtt
gttggtcttgatccagcattgatgggtctgggaccatattatgcaatcaataagctctta
aaaaatcagcagatggcggcagatgacgtggatacttacgaaattaatgaagcgtttgcg
acccaagcccttgtctgtcaggaattgcttcatcttgatcctaatgctgtcaatccttgg
ggtggagcaattgcgttaggccatccagttgggtgttcaggcgcgcgaattatcgtcacg
atgattaatgaaatgcattgggataatcatgaactcggcattgcttcgctgtgtgtcggg
ggcggaatgggtgaagcggttctgcttaagaaaatttag

DBGET integrated database retrieval system