KEGG   Lactobacillus reuteri I5007: LRI_1705Help
Entry
LRI_1705          CDS       T02701                                 

Definition
(GenBank) D-alanine-D-alanyl carrier protein ligase
  KO
K03367  D-alanine--poly(phosphoribitol) ligase subunit 1 [EC:6.1.1.13]
Organism
lrt  Lactobacillus reuteri I5007
Pathway
lrt00473  D-Alanine metabolism
lrt01100  Metabolic pathways
lrt01503  Cationic antimicrobial peptide (CAMP) resistance
lrt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lrt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    LRI_1705
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LRI_1705
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    LRI_1705
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:lrt01504]
    LRI_1705
Enzymes [BR:lrt01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.13  D-alanine---poly(phosphoribitol) ligase
     LRI_1705
Antimicrobial resistance genes [BR:lrt01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    LRI_1705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AGN99914
UniProt: R9WIB0
Position
1751777..1753303
Genome map
AA seq 508 aa AA seqDB search
MSKNIITVFEQIAKDNSTRIAYDEMGKTTTYADLSSAVDTLAAWLSTQSLPDRSPILVYG
DHQVEMIISFLAALKAGHTYIPVSNDSAIPRMQSILDTAKPAMIIAVNDFPSNDLQFDAP
IVDHQQLEKILATPQTFDTSAMINGDELAYVLFTSGTTGSPKGVEVSHDNFMTFVDWMLS
DEFQIKEHANFLGQPPYSFDLSNMYWLPALLNGGTIKALPHEVVENFGQMFTALPNLDLE
VFVGTPSFADMLMLSPAFNQQKMPSLKTFLFCGEELTVKTAKGLHQRFPDAKIFNTYGPT
ETTVAVSGIEITPGIIENNDRLPVGYAKPGVKLSIWNGNQEITTPGEQGEIVISGNSVAH
GYMNNPEKTAKSFFKIDGVPAYRTGDAGTLDSDGLLHHKGRMDFQIKLHGYRIELDEVRA
SLEKSPLIKQAVAVPKYNKDGKVTHLIAYVIPNEATEDTAGLTKQIRESLDGLIMPYMMP
TQFVYRESFPMSANGKIAVKQMIAEANK
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagaatattattactgtctttgagcaaattgccaaggacaactcaacgcggatc
gcatatgatgaaatgggcaaaacgaccacctatgcggacttaagctcagcagttgatact
ttagcggcatggcttagtactcaatctttgcctgatcgtagtccgattctcgtatatggt
gatcatcaagttgaaatgattattagctttttagcagctctaaaagctggacatacttat
attccagtgtccaacgattcagcaattccacggatgcaatcaattctggatactgctaaa
ccggcgatgattattgctgttaatgattttccaagcaatgatctccagtttgatgcccca
attgtcgatcatcaacagcttgaaaaaattttggcaacaccacaaacttttgatacttca
gcaatgattaatggtgacgaactagcttatgtcctctttacgtctggaactactggttcg
ccaaagggggttgaagttagtcacgataactttatgacctttgttgactggatgttaagt
gacgagtttcaaatcaaagaacatgctaatttcttaggtcaaccaccatactcatttgac
ctttcaaatatgtactggttaccggcattacttaacggggggacaatcaaggcgcttcct
cacgaagttgttgagaattttggtcagatgtttactgctctaccaaaccttgatcttgaa
gtttttgtagggacgccatcatttgctgatatgttaatgcttagcccagcatttaaccaa
caaaaaatgccaagcttaaagacctttctcttctgtggtgaagaattaacagtaaaaact
gcaaaaggattacatcagcgattcccagatgctaaaatcttcaacacttacggtccaact
gaaacaacagttgccgtatcaggaatcgaaatcacaccaggaatcattgaaaataatgat
cgcctaccagttggctatgctaagccaggagtcaaattatccatttggaatggcaatcaa
gaaatcactactcctggtgaacaaggtgaaattgtaattagtggtaatagtgtggcacat
ggctacatgaataatccagaaaaaacagccaagtcattctttaagattgatggtgtgcct
gcttaccgaactggggatgcgggaactcttgacagcgatggcttacttcaccacaaaggc
cgcatggatttccaaattaaattacatggttaccggattgaacttgatgaagttcgtgcc
tctcttgaaaagagtcctttaatcaaacaagcagttgcggttccgaaatataataaagat
ggcaaagttacgcacctgattgcttatgttattccaaacgaagcgactgaagatacggct
ggattaacaaaacagattcgtgaaagcttggacggcttaatcatgccatatatgatgcct
acccaattcgtttaccgtgaatcattcccaatgtctgcaaatggcaagattgcagttaaa
caaatgattgctgaggctaacaagtaa

DBGET integrated database retrieval system