KEGG   Lactobacillus reuteri SD2112: HMPREF0538_21197Help
Entry
HMPREF0538_21197  CDS       T01551                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lru  Lactobacillus reuteri SD2112
Pathway
lru00071  Fatty acid degradation
lru00072  Synthesis and degradation of ketone bodies
lru00280  Valine, leucine and isoleucine degradation
lru00362  Benzoate degradation
lru00620  Pyruvate metabolism
lru00630  Glyoxylate and dicarboxylate metabolism
lru00640  Propanoate metabolism
lru00650  Butanoate metabolism
lru00900  Terpenoid backbone biosynthesis
lru01100  Metabolic pathways
lru01110  Biosynthesis of secondary metabolites
lru01120  Microbial metabolism in diverse environments
lru01130  Biosynthesis of antibiotics
lru01200  Carbon metabolism
lru01212  Fatty acid metabolism
lru02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HMPREF0538_21197
   00630 Glyoxylate and dicarboxylate metabolism
    HMPREF0538_21197
   00640 Propanoate metabolism
    HMPREF0538_21197
   00650 Butanoate metabolism
    HMPREF0538_21197
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HMPREF0538_21197
   00072 Synthesis and degradation of ketone bodies
    HMPREF0538_21197
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HMPREF0538_21197
   00310 Lysine degradation
    HMPREF0538_21197
   00380 Tryptophan metabolism
    HMPREF0538_21197
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HMPREF0538_21197
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HMPREF0538_21197
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HMPREF0538_21197
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lru04147]
    HMPREF0538_21197
Enzymes [BR:lru01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HMPREF0538_21197
Exosome [BR:lru04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HMPREF0538_21197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C SpoVAD ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AEI57407
UniProt: F8DR84
Position
1186532..1187710
Genome map
AA seq 392 aa AA seqDB search
MEKVYIVAAQRTPIGKFNGQLASKSAVELGAIAIKAAVEKAKLSGNDIDQVLMGNVIQAG
TGQNPARQASMAAGLGEQVPAITINDVCASGMSSVNLAASLIRAGQANVIVAGGMESMSQ
APYVLPKARNGYRFGNGTLLDAMQSDALNDVYGGYPMGITAENINDKYQITRRQQDEFAL
LSHQRAVKAQKAGYFDSEIVPVEVKQKRTTVTVKVDEAPRPDTSLVALAKLKPAFKSDGS
VTAGNASGINDGGAALVLASESAVNQLGLTPLAEWQGSTVVGLDPALMGLGPYYAINKLL
KNQQMAADDVDTYEINEAFATQALVCQDLLHLDPSAVNPWGGAIALGHPVGCSGARIIVT
MINEMHWDNHELGIASLCVGGGMGEAVLLKKI
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggagaaggtttacattgttgctgctcagcgaacaccaatcggtaagtttaacggtcag
ttagcttcaaagtctgcagttgaattaggagcgattgcaattaaagcggctgttgaaaag
gcaaagctcagcggaaacgatattgaccaagtattaatggggaatgttattcaagcagga
acgggacaaaatccagctcgtcaagcatcaatggccgctggcttaggtgagcaggttccg
gcaataacgattaatgacgtctgtgcgtcgggaatgtccagtgttaacctggcagcaagt
ttaattcgtgcaggacaggctaatgtaattgttgctggggggatggaaagtatgtcccaa
gccccatatgttcttcctaaagcacggaatggttatcggtttgggaatggaaccttactt
gatgcaatgcaaagtgatgctttaaatgacgtttatggcggttatccaatgggaattact
gctgaaaatatcaatgataagtatcagattactcgtcgccagcaagacgaatttgctttg
ttgagccatcaacgtgcagtaaaagctcaaaaagcaggctatttcgattcagaaattgtg
cccgttgaagttaagcagaaacgaaccactgtaactgtaaaggttgacgaagcaccacga
ccagatacttccctagtggctttagcaaaattaaaaccagcttttaaatctgacggaagt
gtgactgcaggaaatgcctcgggaattaatgatgggggagctgctttggttcttgcttct
gaaagtgcagtcaatcaattaggattaactccattggctgagtggcaaggatctacagtt
gttggtcttgatccagcattgatgggtctgggaccatattatgcaatcaataagctctta
aaaaatcagcagatggcggcggatgacgtggatacttacgaaattaatgaagcgtttgcg
acccaagcccttgtctgtcaggacttgcttcatcttgatcctagtgctgtcaatccttgg
ggtggagcaattgcgttaggccatccagttgggtgttcaggcgcgcgaattatcgtcacg
atgattaatgaaatgcattgggataatcatgaactcggcattgcttcgctgtgtgtcggg
ggcggaatgggtgaagcggttctgcttaagaaaatttag

DBGET integrated database retrieval system