KEGG   Luteibacter rhizovicinus DSM 16549: BJI69_01765Help
Entry
BJI69_01765       CDS       T04563                                 

Definition
(GenBank) glutathione synthase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
lrz  Luteibacter rhizovicinus DSM 16549
Pathway
lrz00270  Cysteine and methionine metabolism
lrz00480  Glutathione metabolism
lrz01100  Metabolic pathways
Module
lrz_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:lrz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BJI69_01765
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BJI69_01765
Enzymes [BR:lrz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     BJI69_01765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD ATPgrasp_ST ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: APG02762
UniProt: A0A0G9HFB3
Position
372631..373572
Genome map
AA seq 313 aa AA seqDB search
MSLSVAVLMDPIRAIKIAKDSTFAMLLEASRRGHALLYMEQGDLALRNGEAWARLRPLTV
KEDPTGWFTLGEAAWRPLAEVDIVLARKDPPVDAQFIYDTMVLERAQRAGCKVVNDPRSL
RDCNEKLFALDFPQCIAPTLVSRDAGELRRFVAEHGEAVLKPLDGMGGRGIFRVRHGDSN
LNSMLETLLDGAHHFAIAQKYIPEITAGDKRILLIDGEPVPYALARIPQGDEFRGNLAAG
GRGEGIPLSDRDRWIAAQVAPELVRRGLRFVGLDVIGDYLTEINVTSPTCIRELDAQFGI
NIAGLMFDAIEAR
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctctccgtcgccgtcctgatggacccgatccgcgccatcaagatcgccaaggac
tccaccttcgccatgttgctggaggcttcccgccgtggccatgccttgctgtacatggag
cagggcgacctggctctgcgcaacggcgaggcctgggcccgcctgcgtccgctcaccgtg
aaggaagatccgaccggctggttcaccctgggcgaggccgcctggcgccctctcgccgag
gtcgacatcgtcctggcccgcaaggatccgccggtggatgcccagttcatctacgacacc
atggtcctggagcgcgcccagcgtgccggctgcaaggtagtcaacgacccgcgcagcctg
cgcgattgcaacgagaagctgtttgccctggatttcccccagtgcatcgcgccgaccctg
gtctcccgggacgccggcgagctgcgccggttcgtcgccgaacacggtgaagccgtgctc
aagccgctggacggcatgggcgggcgcggcatcttccgggtcaggcacggcgactccaac
ctcaattccatgctggaaaccctgctcgacggcgcccatcacttcgccatcgcgcagaag
tacattccggagatcaccgccggtgacaagcgcatcctgctgatcgatggcgagccggtg
ccctatgcgttggcccgcatcccccaaggcgacgaatttcgcggaaatctcgccgccggc
ggccgcggggaaggcatccccctgtccgaccgtgaccgttggatcgccgcccaggtcgcc
ccggagctggtccgccgtggcctgcgtttcgtcggcctggacgtgatcggcgactacctg
accgagatcaacgtcacatctccgacatgcatccgcgaactggatgcccagttcggcatt
aacatcgcagggctgatgttcgacgcaatcgaggcccgatga

DBGET integrated database retrieval system