KEGG   Luteibacter rhizovicinus DSM 16549: BJI69_03645Help
Entry
BJI69_03645       CDS       T04563                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
lrz  Luteibacter rhizovicinus DSM 16549
Brite
KEGG Orthology (KO) [BR:lrz00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BJI69_03645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 Chitin_bind_4
Motif
Other DBs
NCBI-ProteinID: APG03086
UniProt: A0A0G9H8K4
Position
768396..768779
Genome map
AA seq 127 aa AA seqDB search
MNSKTPYTIDVEVESRFVPDQSQPTDNRYVFAYTITLRNAGETGAQLMTRHWVIKDANGK
VEEVRGDGVVGEQPWMRPGESFEYTSGAVLETAVGTMEGSYSMVADDGTRFDAPIPTFVL
SIPRTLH
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgaattccaaaacaccctacacgatcgacgtggaggtcgaatcccgcttcgtccccgac
cagtcgcagcctaccgacaaccgctacgtcttcgcctacacgatcacgctgcgcaatgcc
ggcgagactggcgcgcaactgatgacccgccactgggtcatcaaggatgcgaacggaaag
gtcgaggaagtgcgcggcgacggcgtggtcggcgagcaaccgtggatgcgacccggcgag
tcgttcgagtacacctccggcgccgtcctcgagacggcggtgggcaccatggaaggcagc
tacagcatggtggccgatgacggcacgcggttcgacgccccgattccgactttcgtgctt
tcgataccgcgcacgctccactag

DBGET integrated database retrieval system