KEGG   Luteibacter rhizovicinus DSM 16549: BJI69_06150Help
Entry
BJI69_06150       CDS       T04563                                 

Definition
(GenBank) glycosyl hydrolase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
lrz  Luteibacter rhizovicinus DSM 16549
Pathway
lrz00511  Other glycan degradation
lrz00600  Sphingolipid metabolism
lrz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lrz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    BJI69_06150
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BJI69_06150
Enzymes [BR:lrz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     BJI69_06150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C Glyco_hydro_59
Motif
Other DBs
NCBI-ProteinID: APG06384
UniProt: A0A0G9H6C9
Position
complement(1336550..1337977)
Genome map
AA seq 475 aa AA seqDB search
MPSVAVWLSTTDHRSKLAPQPDIPVSPRGSATADIVIDPTTRYQSITGFGAAMTDSSAWL
LHTKMSAPERQALLRELYGPPPNLNFNMMRLTIGSSDFSLNVYTLDDIPFGQIDPQLKHF
NIAANLQDVVPMMREVLAINPGMLTIASPWGAPAWMRTTQNLLGGELLEQYEGVYADYLV
KYLDAYRSHGIPIFALTLQNEPAYAPISYPGMTMGAETRARVVSKYLGPKLADRKPRTAI
LEWDHNWTPVEEPLAVLADPDAARYIDGVAWHCYGGSQHEQGRVHRAHPDKDAYITECTG
GDWPLSVNGELLWFSRNLLVTGIRQWARGVVYWNLALDENHGPHFGGCSRCRGVVTIDSE
TGEVTRNDEYYALAHFSRFVEPGAFRVNSNDTDVDDRGIANVAFQNESDGSLVLVVVNLN
KDERRLSVTDGRNRFEYAMPAESVATFVWDPDLPAGWIRRAQRWLSGARPQARVD
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgccttctgtcgcggtctggctcagcaccaccgatcaccggtcgaagctggccccgcag
cccgatatcccggtgagcccccgtggttcggcgaccgccgatatcgtcatcgatcccacc
acccggtaccagagcatcacgggtttcggcgcggcgatgacggattcctcggcgtggcta
ctccatacgaagatgagcgcgcccgagcgccaggcactgttgcgcgagttgtatggtccg
ccgccgaacctcaacttcaacatgatgcggctgacgatcggctcgtctgatttctcgttg
aacgtttacacgctcgacgacattccgttcggccagatcgatccgcagttaaagcatttc
aacatcgcggccaacctccaggacgtggtgccgatgatgcgggaagtcctcgccatcaat
cccggcatgctcacgatcgcttcgccgtggggcgcgccggcgtggatgcgcaccacccag
aatctgcttggtggcgagctgctggagcagtacgagggcgtctacgcggactacctcgtc
aagtatctcgatgcctaccgcagccacggcattcccatctttgccctgaccttgcaaaac
gaacccgcgtacgcaccgatcagctaccccggcatgacgatgggtgcggagacgcgggcc
cgcgtggtctcgaagtacctcggaccgaagctcgctgaccgaaagcccaggacagccatc
ctcgagtgggatcacaactggacgcctgtcgaagagccgctggccgtcttggccgacccc
gatgccgcgcgttacatcgacggcgtggcgtggcattgctacggcggcagccagcacgag
cagggccgcgtccatcgtgcccaccccgataaagatgcttacatcacggaatgcaccggt
ggcgactggccgttgtcggtcaacggcgaattgctgtggttctcacgaaacctgctggtc
accggcatccggcagtgggcccgcggcgtcgtctactggaaccttgcgctggacgagaac
cacggtccgcatttcggcgggtgctcgcgttgccgcggcgtcgtcaccatcgattcggaa
acgggcgaggtgacacgcaacgacgagtattacgcgctggcgcacttcagccggttcgtc
gaaccgggcgcgttccgggtgaattccaacgataccgatgtcgacgacaggggcatcgcc
aatgtcgcttttcagaacgagtccgatggctcgctcgtcctggtggtggtgaacctcaat
aaggacgaacgccgtctctcggtaacggacgggcgtaaccgtttcgagtacgcgatgccg
gcggaaagcgtggcgacgttcgtgtgggatccggaccttcccgcgggttggattcgacgc
gcccagcggtggctgagcggagcgcgcccgcaggcgcgcgtcgactag

DBGET integrated database retrieval system