KEGG   Luteibacter rhizovicinus DSM 16549: BJI69_07025Help
Entry
BJI69_07025       CDS       T04563                                 

Definition
(GenBank) succinate-semialdehyde dehydrogenase
  KO
K08324  succinate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.24]
Organism
lrz  Luteibacter rhizovicinus DSM 16549
Pathway
lrz00250  Alanine, aspartate and glutamate metabolism
lrz00650  Butanoate metabolism
lrz00760  Nicotinate and nicotinamide metabolism
lrz01100  Metabolic pathways
lrz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lrz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BJI69_07025
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BJI69_07025
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BJI69_07025
Enzymes [BR:lrz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     BJI69_07025
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     BJI69_07025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: APG03682
UniProt: A0A1L3ERN9
Position
complement(1553107..1554522)
Genome map
AA seq 471 aa AA seqDB search
MTSPSNHPANAYADGGISRNPADDTFIAAYPYQTADDVERMLDENASAFRQWRATPMAER
VAAYHRLASTLRDRLETLALIITSEMGKPLVDSRAEVEKCAATLDWIAENGPGILADEPV
PVDGDDQVHVSYLPIGSILGVMPWNFPLWQAIRASGPIMLSGNGFILKHAPNVMGAAYAL
QQAYETAGFPKGLFVNLHADNETVARVIEDPRVAAVTVTGSMRAGAAVASTAAKVLKKSL
LELGGSDPFIVLADANIDLAVETAVQARFQNTGQVCLAAKRFILEKPIAAEFTRKFVEAV
KALTMGDPTDPSNKLGPMARTDLRDELHSQVERTLAQGASLLLGGKKVEGPGNFYEPTVL
GNVGPGMTAFDEETFGPVAAMTVADNVEHAIELANTSDYGLSGNLWTADTARAQRIARRL
ETGGVFINGFSASNARIPVGGVKKSGYGRELSHFGLREFTNAQAVWTKTVE
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgacctcaccttcgaatcatcctgcgaatgcttacgccgacggcggtatctcccgcaat
ccggcggacgacacgtttatcgcggcgtatccctaccagaccgccgatgacgtcgagcgc
atgctcgacgagaacgcgtcggcatttcgccagtggcgcgccacgccgatggccgagcgg
gtggcggcctaccatcgcctggcgtccacgctgcgggaccgtttggaaaccctcgcgctg
atcatcactagcgagatgggtaaaccactcgtcgactcccgtgccgaggttgaaaaatgc
gccgccacgctggactggatcgcggagaacggcccggggattctcgccgacgaaccggtg
ccggtcgacggggacgatcaggtgcatgtgtcatatcttccgatcggcagcatcctcggc
gtgatgccgtggaacttccccctctggcaggcgattcgggcctcggggccgatcatgctc
tcgggcaacggtttcatcctcaagcatgcgccgaacgtcatgggtgccgcctacgcattg
caacaggcttacgagaccgccggttttccgaagggtctcttcgtcaacctgcatgcggac
aacgagacggttgcacgcgtcatcgaggacccgcgggtcgctgcagtcacggtgaccgga
agcatgcgcgcgggtgccgccgtggcctcgacggcagcgaaggtgctcaagaagagcttg
ctggaactaggcggcagcgatccgttcatcgtgctggccgatgcaaacatcgatcttgcc
gtggagacggcggtccaggcgcgtttccagaacacggggcaggtttgcctggccgccaag
cgcttcattctggaaaaaccgatcgctgcggaattcacccgcaagttcgtcgaagcggtg
aaagccctgacgatgggtgaccccaccgacccgtcgaacaaactcggtcccatggcccgg
actgacctgagggacgagctgcatagccaggtcgagcggaccctggcgcaaggtgcgtcc
ttgcttctgggcggcaagaaggtcgaaggcccgggtaatttctacgagccgaccgtgctg
ggtaacgtcggtccgggcatgacggctttcgacgaggaaaccttcggccccgtcgcggcg
atgaccgtcgctgacaacgtcgaacacgccatcgagctggccaacacgagcgactacgga
ctcagcggcaatctgtggacggccgacacggcccgcgcgcagcgcattgcgcggcgcctg
gagacgggtggtgtgttcatcaatggcttcagcgcctccaacgccaggattcccgtaggt
ggcgtgaagaagagcggctacggacgcgagctgtcgcacttcgggctgcgcgagttcacc
aacgcccaggctgtctggacgaagacagtcgagtga

DBGET integrated database retrieval system