KEGG   Luteibacter rhizovicinus DSM 16549: BJI69_11715Help
Entry
BJI69_11715       CDS       T04563                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
lrz  Luteibacter rhizovicinus DSM 16549
Brite
KEGG Orthology (KO) [BR:lrz00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BJI69_11715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 DUF1495
Motif
Other DBs
NCBI-ProteinID: APG04497
UniProt: A0A0G9HD37
Position
2606821..2607945
Genome map
AA seq 374 aa AA seqDB search
MSMVIAVVLIALAFTYINGFHDTANSIATVVATKVLTPGQAVLLAAVTNLAGALWGTAVA
ATIASGLIDTGVVDVGSQLLISALLGATIWNLITWWMGLPSSSSHALVGGLCGAALAASD
GNLHSIIWWQGGAHWWLGKGVMPKVILPMMVSPFLGFVIGYALMGSLYALLGFFSSRKGP
LRRFGRTPFVNSFFGKAQIVSASAMGLSHGMNDAQKSMGIIALALAGATAAGHFDHLPAI
LHFLRIPHDPAAPGGFPIPVWVKVVCALTMAAGTAGGGWRIIKTLGHKMVKLHPINGFAA
EGSSAAVILTASILGVPVSTTHNVSASIMGVGAAKRWNAIRWSVVERMVWAWILTLPITA
GIGYGLVKLSRLFF
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgagcatggtcatcgcggtcgtcctgatcgccctcgcgttcacctatatcaacggcttc
catgacacggcgaactccatcgccaccgtggtcgcgaccaaggtcctcacaccgggccag
gccgtacttctggcggcggtcaccaacctggcgggcgccctgtggggcacggccgtggcg
gcgacgatcgcgtcgggcctgatcgacaccggggtggtggacgtcggctcacagctgctg
atcagcgcactgctcggggcgacgatctggaacctgatcacctggtggatgggtctgccg
tcgagctccagccacgccctggtcggtggcttgtgcggcgcggccctggcggcgtccgac
ggcaacctgcactcgatcatctggtggcagggcggggcgcactggtggctgggcaagggc
gtcatgcccaaggtcatcctgccgatgatggtctcgcccttcctgggtttcgtcatcggc
tatgcgttgatgggcagcctgtatgcgctgctcggcttcttctcgagccgcaagggtccg
ctacgccgtttcggccgcaccccgttcgtcaacagttttttcggcaaggcacagatcgtc
tcggccagcgcgatgggtctgtcccatggcatgaacgacgcgcagaaaagcatgggcatc
atcgccctcgccctggctggtgccacggcggcgggtcacttcgaccatctgcccgcgatc
ctgcatttcctgcgcattccgcacgaccccgctgcgcccggtggcttcccgatcccggtc
tgggtcaaggtcgtctgcgcgctgaccatggccgcgggtaccgcaggcggtggctggcgc
atcatcaagacgctgggccacaagatggtcaagctgcacccgatcaacggcttcgcggcc
gagggcagctcggcggcggtcatcctcaccgcgtccatcctcggcgtaccggtgtcgacg
acgcacaacgtgtcggcgtcgatcatgggcgtcggtgccgcgaagcgctggaacgccatc
cgctggtccgtggtcgagcggatggtctgggcgtggatcctcaccctgccgatcacggca
ggcatcggctacggcctggtcaagctcagccggctgttcttctga

DBGET integrated database retrieval system