KEGG   Luteibacter rhizovicinus DSM 16549: BJI69_12595Help
Entry
BJI69_12595       CDS       T04563                                 

Definition
(GenBank) geranyl transferase
  KO
K00795  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
lrz  Luteibacter rhizovicinus DSM 16549
Pathway
lrz00900  Terpenoid backbone biosynthesis
lrz01100  Metabolic pathways
lrz01110  Biosynthesis of secondary metabolites
lrz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lrz00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BJI69_12595
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:lrz01006]
    BJI69_12595
Enzymes [BR:lrz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     BJI69_12595
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     BJI69_12595
Prenyltransferases [BR:lrz01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   BJI69_12595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt UbiA
Motif
Other DBs
NCBI-ProteinID: APG06521
UniProt: A0A1L3EZN2
Position
complement(2795515..2796417)
Genome map
AA seq 300 aa AA seqDB search
MPTSTDLPAPLKALVGRADEALARALPGGDLPPVELHGAMRYAVLGGGKRLRPLLVYAAG
HALGRDDGILDAPACAVEIIHAYSLVHDDLPAMDDDALRRGRPTCHIVYGEAMAILAGDA
LQALAFEILATPHGDHDDPLARIAMLRALGAACGAEGMAGGQAFDLSAVGQKLSLVDLER
MHAYKTGALIRASVRLGALAAGCTDPDLLSRLDRYGHAVGLAFQVRDDILDVEGESAVIG
KTAGKDAAADKPTFPSIIGLPASRERLDTLVRDALDAIEPLGTRGEWLADLARYSAQRAH
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
attcccacatcgactgacctgccggcgccactgaaggcgctggtcggccgggctgacgag
gcgctggcgcgcgcgttgcccggcggcgaccttcctcccgtggaactgcatggcgccatg
cgctacgccgtcctcggcggtggcaaacgcctgcgcccgctgctggtctacgcagccggg
cacgcactcggccgcgacgacggcatcctcgatgcacccgcctgcgccgtggagatcatc
cacgcgtattcgctggtgcacgacgacctgccggcgatggacgacgacgccctgcgtcgc
ggccggcccacctgccacatcgtctacggcgaagccatggcgatcctcgccggtgacgca
ctgcaggcgctggctttcgagatcctcgccacgccgcacggcgaccatgacgatccgctg
gcgcgcatcgccatgctgcgcgccctcggcgccgcctgcggcgccgagggcatggccggc
ggccaggctttcgatctttccgcggtgggccagaagctgtcactggtggatctcgagcgc
atgcacgcctacaagaccggcgccctcattcgcgcttcggtgcgcctgggcgccctcgca
gccggctgcaccgatcccgacctgctcagccgcctggaccgttacggtcatgccgtgggc
ctggctttccaggtgcgcgacgacatcctcgacgtggaaggcgaatccgccgttatcggc
aagaccgccggcaaggacgccgccgccgacaagcccaccttcccgtcgatcatcggcctg
cccgcctcacgcgagcgcctcgacaccctcgtccgcgatgccctcgacgccatcgaacca
ctcggcacacgcggcgaatggctcgccgacctggcgcgttactccgcccagcgcgcgcac
tga

DBGET integrated database retrieval system