KEGG   Luteibacter rhizovicinus DSM 16549: BJI69_15225Help
Entry
BJI69_15225       CDS       T04563                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
lrz  Luteibacter rhizovicinus DSM 16549
Pathway
lrz00450  Selenocompound metabolism
lrz00970  Aminoacyl-tRNA biosynthesis
lrz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lrz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BJI69_15225
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BJI69_15225
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lrz01007]
    BJI69_15225
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lrz03016]
    BJI69_15225
Enzymes [BR:lrz01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BJI69_15225
Amino acid related enzymes [BR:lrz01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BJI69_15225
Transfer RNA biogenesis [BR:lrz03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BJI69_15225
 Prokaryotic type
   Other AARSs
    BJI69_15225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: APG05112
UniProt: A0A0G9HIP3
Position
complement(3334532..3336640)
Genome map
AA seq 702 aa AA seqDB search
MARRILVTNALPYANGPLHLGHMLGYIQADIWARAQRMQGNEVWYVAGEDAHGTPIMLAA
EKVGKSPEDYIAAIRAGHEADFTDFHFSYDQYHTTHSPENRELATSIYTRLRDAGYIARR
DIQQLYDPERDMFLPDRYIKGTCPNCGTPDQYGDNCENCGATYAPTDLINPYSVMSGATP
ILRDSEHYFFELGKFEQLLRDWFAGKLTGGKPVAHSSVSAKLAEWLDGGLRDWDISRDAP
YFGFPIPDAPGKFFYVWLDAPVGYLASFKALCERTDLRFDDFLGTDSTTEMHHFIGKDII
NFHGLFWPAMLHGAQMRVPTALHVNGYLTVNGAKMSKSRGTFIQARTYLASGLDPEALRY
YFATMLSATPVDVDLDLKSFEERVNSHLVGKWANIASRTAGFLHTYFAGKLADRFDDEAQ
AIWRDLLAQYDGIEGVYEADDFAEVSRRFVAMSDAVNGYIAAKAPWVIARDDARRDELQQ
VCSFAINAFRLLSGMLKPILPTTVAAAEAFLGAPVSDFADARRELHGHTVNAFSPLFGRL
DPKKIEAMVEGSKESLTPAEQARANAPAAKKPFKSKEASPPMTDIAPAADTAATISIDDF
AKLDLRIGKVLACEFVEGSDKLLRFELDGGPLGKRQIFSGIRAAYGEPEKLLGRNVVFIA
NLAPRKMRFGLSEGMILSAGDGGADLFLLDADQGATPGATVR
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atggcccgccgcatactcgtcaccaacgccctcccctacgctaatggcccgctgcatctg
ggccacatgctcggctatatccaggccgacatctgggcgcgcgcgcagcgaatgcagggt
aacgaggtctggtacgtcgctggcgaagatgcgcacggcacgccgatcatgctggccgcc
gagaaggtcggtaagagccccgaggactacatcgcggcaatccgcgcgggtcacgaagcg
gacttcaccgacttccacttcagctacgaccagtaccacaccacgcactcgcccgagaat
cgtgaactcgcgacctcgatctacacgcgcttgcgcgacgccggctacatcgcccgtcgc
gatatccagcagctgtacgatcccgagcgcgacatgttcctgccggaccgctacatcaag
ggcacctgcccgaactgtggcacgcccgaccagtacggcgacaactgcgagaactgcggc
gccacctatgcgccgaccgacctgatcaacccgtattcggtgatgtcgggcgcgacgccg
atcctgcgcgactccgagcactacttcttcgaactggggaagttcgagcagctgctgcgc
gactggttcgccggcaagctcaccggcggcaagcccgtggctcacagcagcgtttccgca
aagctcgccgagtggctcgacggcggtttgcgcgattgggacatctcccgcgacgcaccc
tacttcggcttcccgattccggatgcgccgggcaagttcttttacgtatggctcgatgcg
ccggtgggttacctcgcctcgttcaaggcgttgtgcgagcgcaccgacctgcgcttcgac
gacttcctcggtaccgacagtacgaccgagatgcaccatttcatcggtaaggacatcatc
aacttccacggcctgttctggccggcgatgttgcatggcgcgcagatgcgcgtgccgacg
gcgctgcacgtcaacggttacctgaccgtcaacggcgcgaagatgtcaaagtcgcgcggc
accttcatccaggcacgcacctaccttgcgtcgggcctggatccggaagcgctgcgctac
tacttcgccacgatgctcagcgccacgccggtcgatgtcgacctcgatctgaagtccttc
gaggagcgtgtcaactcgcacctcgtcggcaagtgggcgaacatcgccagccgtaccgcg
ggattcctgcacacctatttcgccggcaaactggccgatcgtttcgacgacgaggcccag
gccatctggcgcgacctgctcgcccagtacgacggcatcgaaggggtctacgaagcggac
gacttcgccgaagtctcgcgtcgcttcgtcgccatgtccgatgccgtgaatggctatatc
gctgcgaaagcaccctgggtcatcgccagggacgacgcgcgccgcgacgaactgcagcag
gtctgctcgtttgcgatcaacgccttccgcctgctctccggcatgctcaagccgatcctg
ccgacgaccgtcgccgccgccgaagccttcctcggcgcacccgtcagcgacttcgccgac
gcgcgtcgcgagctgcatgggcacaccgtcaacgccttctcgccgctgttcggccgcctc
gatccgaaaaagatcgaagccatggtcgaggggtcgaaggagtcgttgacgccggccgaa
caggccagggccaacgcgccggccgccaagaaaccgttcaaatccaaagaagcctctccg
cccatgaccgacatcgctcccgccgccgatacggccgccaccatttcgatcgacgacttc
gccaagctcgacctgcgcatcggcaaggtgctggcctgcgagttcgtcgaaggctccgac
aagctgctgcgtttcgagctcgacggcggcccgctgggcaagcgccagatcttctcgggt
atccgtgccgcctatggcgagccggaaaagctcctgggtcgcaacgtcgtcttcatcgcc
aacctcgccccgcgcaaaatgcgcttcggcctgtcggaaggcatgattctttccgcgggt
gatggcggcgccgacctgttcctgctcgacgccgaccagggcgcgacgccgggcgccacc
gtccgctga

DBGET integrated database retrieval system