KEGG   Luteibacter rhizovicinus DSM 16549: BJI69_21290Help
Entry
BJI69_21290       CDS       T04563                                 

Definition
(GenBank) xanthomonalisin
  KO
K05999  xanthomonalisin [EC:3.4.21.101]
Organism
lrz  Luteibacter rhizovicinus DSM 16549
Brite
KEGG Orthology (KO) [BR:lrz00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lrz01002]
    BJI69_21290
Enzymes [BR:lrz01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.101  xanthomonalisin
     BJI69_21290
Peptidases and inhibitors [BR:lrz01002]
 Serine peptidases
  Family S53
   BJI69_21290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pro-kuma_activ PPC PKD FctA
Motif
Other DBs
NCBI-ProteinID: APG06188
UniProt: A0A1L3EYR3
Position
complement(4686917..4689394)
Genome map
AA seq 825 aa AA seqDB search
MKIAKTALTVAIALAMTSLSAHAEDAWVSTHTKAAMLPVAAPQALAASSTTSTPVTSGYA
LNMTGSPHIEGAAVTALEADHPLHVVVSLKLRNPDQLQTFLAGVTTPGNAQYGKFLSPAQ
FKAQFGPTQAQVDAVVAHLQQAGFSNIEVAPNNLLISADGNAGAATTGFHTSIKRFTSNG
REFFANDTPALVPAALGDAVGSVLGLQNVSVKHTLHHVYHPENVTVPGPASSTQAAAAVA
AHHPQDFAAIYGASGVPAATNTAVGIITWGSITQTVTDLNSFTSGAGLATVNSTITKVGS
GTFANDNDSNGEWSLDSQDIIGISGGVKQLIFYTSPNGDSNSSGITDAGITATYNRAVTD
NIVKLVNVSLGEDETAAEESGTQAADDAIFQQAVAQGQTFSIASGDAGVYQWSTDPTSGS
PGYVANSAGTVKIDLTHYSVSEPASSPYVIQVGGTQLSTSGTTWSGETVWNEGLSAIAPS
QGDNNQRLWATGGGTSLYETAPSWQSVVSSSTKRVGPDLAFDAASASGALIIIAGQTEQV
GGTSLASPLFVGAFARIESAANNAIGFPASKFYGAFPTQTSLLHDVTSGNNGYQNHGYTA
ATGFDETTGFGSFDIGKLNTYAQANWVTGGGGGTNVPPVANFSVVTSGLTATFTDSSTDS
DGSIASHAWNFGDGSTSTATSPSHTYTAAGTYTVSETVTDNAGATNAKSSSVTVTSSGGG
GGNTLQNGVAVTGLSAAKNAKLNYTVAVPAGAKNLKIVISGGSGDADLYVKFGSAPTTST
YDCRPYVTGNAETCSFTTPSTGTYYVMLNAYAAFSGVSLKASWTN
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atgaagattgcaaaaacggcgttgacagtggcgattgcactggcgatgacctcactttcc
gcgcacgcggaagacgcatgggtttccacgcataccaaggccgcgatgctccccgtcgcc
gcaccgcaggcgcttgctgcgagttccacgacgtcgacgccggtgaccagcgggtacgca
ctgaacatgaccggttcgccgcacatcgaaggcgcggccgttaccgcactcgaagccgat
catccgctgcacgtcgtggtcagcctcaagctgcgcaatcccgaccaactgcagaccttc
ctcgccggcgtgaccacgccaggcaacgcgcagtacggcaagttcctctcgcccgcgcag
ttcaaggcgcagttcggtccgacgcaggcgcaggtcgacgcggtcgtcgcgcacctgcag
caggcgggcttcagcaatatcgaagtggcgcccaacaacctgttgatctccgccgacggt
aacgccggtgccgcgacgacaggcttccacacgtcgatcaagcgtttcacttcaaatggc
cgcgagttcttcgccaacgacaccccggcactggtgccggcggcgctcggcgacgccgtc
ggttcggtgctcggtctgcagaacgtgtcggtcaagcacaccttgcatcatgtctatcac
ccggagaacgtgaccgtgccggggccggcgtcgagcacgcaggcagccgctgccgtcgcc
gcgcatcatccgcaggacttcgccgccatctacggcgcgagcggtgtgccggcagcgacc
aacaccgccgtcggtatcatcacctggggttcgatcacccagacggtgaccgatctgaac
agctttacatcgggcgcgggcctggccacggtcaactcgaccatcaccaaggtcggcagc
ggtacgttcgccaacgacaacgactcgaacggtgagtggtccctcgatagccaggacatc
atcggcatctccggtggcgtgaagcagctgatcttctacacctcgcccaatggcgactcg
aactccagcggcatcaccgatgcgggtatcaccgcgacgtacaaccgggcggtgaccgac
aacatcgtcaagctggtcaacgtgtcgctcggcgaagacgaaacggcggccgaagagtcc
ggtacccaggcggcggacgatgcgatcttccagcaggccgtggcccagggccagacgttc
tccatcgcctcgggcgatgcaggcgtttaccagtggtccaccgatccgacctccggctcg
ccgggttacgtggccaactccgccggtacggtgaagatcgatctcacccattactcggtc
agtgagccggcgagctcgccgtacgtcatccaggtcggcggcacgcagttgtcgaccagc
ggaacgacgtggtccggcgaaaccgtgtggaacgaaggcctctcggccattgcgcccagc
cagggcgacaacaaccagcgcctgtgggcgaccggtggcggcaccagtctctatgagacc
gcgccctcgtggcagtccgtcgtgtcgagctcgaccaaacgcgtgggtccggatcttgcg
ttcgatgccgcctcggcatcgggtgcgttgatcatcatcgctggccagaccgagcaggtc
ggcggtaccagcctggcctcgccgttgttcgtcggtgcgttcgcgcgtatcgaatccgcc
gccaacaacgccatcggcttcccggcgtcgaagttctacggcgccttcccgacgcagacg
tcgctgctgcacgatgtgacgtcgggtaacaacggttaccagaatcacgggtacaccgcc
gccacgggcttcgacgagacgacgggcttcggcagcttcgacatcggcaagctcaacacc
tacgcgcaggccaactgggtcaccggtggcggtggtggcacgaatgttccgccggtggcg
aacttcagtgtcgtgaccagcggcctcaccgcgacctttaccgatagctcgacggacagc
gacggcagcatcgcctcgcatgcctggaacttcggtgacggcagcacgtcgaccgcgacg
agcccgagccacacgtatacggcggccggcacgtacacggtaagcgagacggtgaccgat
aacgccggtgccaccaatgccaagagctcgtcggtgacggtcacgtccagcggtggtggc
ggtggcaacacgttgcagaacggtgtggcggtgacgggcctctcggctgcgaagaacgcc
aagctcaactacaccgtggcggttcccgcgggcgcgaagaacctgaagatcgtgatctcg
ggtggttcgggcgatgccgacctctacgtgaagttcggctcggcaccgacgacgtcgacc
tacgactgccgtccgtacgtgaccgggaacgcggagacctgctcgttcacgacgccgtcg
acgggtacgtactacgtgatgctcaatgcctacgccgccttctcgggcgtgtcgctgaag
gctagctggaccaactga

DBGET integrated database retrieval system