KEGG   Lactobacillus sakei: LCA_0405Help
Entry
LCA_0405          CDS       T00299                                 

Gene name
murI
Definition
(GenBank) Glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
lsa  Lactobacillus sakei
Pathway
lsa00471  D-Glutamine and D-glutamate metabolism
lsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    LCA_0405 (murI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lsa01011]
    LCA_0405 (murI)
Enzymes [BR:lsa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     LCA_0405 (murI)
Peptidoglycan biosynthesis and degradation proteins [BR:lsa01011]
 Precursor biosynthesis
  Racemase
   LCA_0405 (murI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race DUF3865 Flavodoxin_3
Motif
Other DBs
NCBI-ProteinID: CAI54706
UniProt: Q38YM1
Position
414104..414928
Genome map
AA seq 274 aa AA seqDB search
MKKQPIGFMDSGVGGLTLVKEARKRLPNEDMVFIGDQARLPYGEKPAATVREFAWQMANF
LRHQEIKALVIACNTATAAALPDLQAQLAIPVIGVIKPGSIAALQTTHNRRVGVIATTGT
IQSAAYSQQMAALNPDVQVTGLAAPQFVTMIEANQRHGQAVQTIVNQILQPLQKSEIDTL
VLGCTHFPLLTTAIQTAVGPDVTLVNPAVQAITMLEEVLTQQQQLATTTPGTLRMYTTGS
VAAFEEIAQQWLAQPDLTAQQVDIQKEKNDGPDR
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaacaaccaattggttttatggattccggtgttggcggtttgacgctagtcaaa
gaagcccgcaaacgcctcccaaatgaagacatggtgtttattggtgatcaagcacgatta
ccttacggcgaaaagccggctgccacagtacgcgaatttgcttggcagatggctaatttc
ttacgccatcaagagattaaggcgctagtgattgcctgtaatacagcaaccgctgcggcc
ttacctgacttacaagcccaattggcgattccggtgattggggttatcaaaccaggtagt
attgcggccctacaaacgacgcataatcgacgtgtcggggtgattgcaacaactggcacg
attcaaagtgcggcttacagtcaacaaatggcagcccttaatcctgatgtgcaagtgact
ggattagcagcaccgcagtttgtgacgatgattgaagccaaccaacgacacggtcaagca
gtgcaaaccatcgtcaatcagattttacaacctttacaaaaaagtgagattgatacgctt
gttttaggctgtacgcattttccattattgacgaccgccattcaaacggcagtggggcct
gacgtgacgttggttaacccagcagtccaagcgattacgatgttagaagaagtcttgacg
caacaacaacaattggcgacaaccacgccagggacgctacggatgtacacaacaggctct
gtcgccgcttttgaagagattgcgcaacaatggcttgcccaaccagatttaacagcacaa
caagttgatattcaaaaggagaaaaatgatggtccggaccgataa

DBGET integrated database retrieval system