KEGG   Lactobacillus sakei: LCA_0821Help
Entry
LCA_0821          CDS       T00299                                 

Gene name
accD
Definition
(GenBank) Acetyl-CoA carboxylase (carboxyl transferase beta subunit)
  KO
K01963  acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2 2.1.3.15]
Organism
lsa  Lactobacillus sakei
Pathway
lsa00061  Fatty acid biosynthesis
lsa00620  Pyruvate metabolism
lsa00640  Propanoate metabolism
lsa01100  Metabolic pathways
lsa01110  Biosynthesis of secondary metabolites
lsa01120  Microbial metabolism in diverse environments
lsa01130  Biosynthesis of antibiotics
lsa01200  Carbon metabolism
lsa01212  Fatty acid metabolism
Module
lsa_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:lsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LCA_0821 (accD)
   00640 Propanoate metabolism
    LCA_0821 (accD)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    LCA_0821 (accD)
Enzymes [BR:lsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     LCA_0821 (accD)
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     LCA_0821 (accD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carboxyl_trans zf-ACC IBR Clc-like zinc_ribbon_4 DUF2256
Motif
Other DBs
NCBI-ProteinID: CAI55125
UniProt: Q38XF6
Position
812264..813115
Genome map
AA seq 283 aa AA seqDB search
MQLFNAVRNIGKAHLKYNQEARQKVPDGLWVACPKCQQSIYHKDLGYYRTCPVCQYGFRT
RAKVRLDWLVDSFEPAGDLAQTPNPLHFPKYPQKLRKAQQITGLEDSILTGVATIKQQKF
ALGIMDPYFIMGSMGSATGEKITRLFELATEKGLPVILIAASGGARMQEGIFSLMQMAKT
SAAVKQHAEQGLLYISLLTDPTTGGVTASFATEADIILAEPKAVIGFAGRRVIEQTMHEQ
IAPDLQDAETVLKNGFIDQIVARQDQKKVLHQLLKLHERGAHY
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgcaattattcaatgccgttcgtaatatcggtaaagcccatcttaaatataatcaagaa
gcacgacaaaaggtgccagacggtttatgggttgcctgtcctaagtgtcagcaatcgatt
tatcataaggaccttggttattaccggacttgtccggtctgtcaatatggatttcggacg
cgggctaaggttcgcctagattggttggtggatagttttgaaccagccggcgatctagcg
caaacgcctaatccgctccattttcccaaatatccgcagaaattgcgaaaagcacagcaa
atcactggactagaagatagtattctgaccggtgttgcgactattaaacaacaaaaattc
gcattaggtatcatggacccttattttattatgggaagcatgggtagtgcgactggtgaa
aaaattacacggctttttgagctagcaactgaaaaaggcttacccgtgattttaattgcg
gcttctggtggtgctcggatgcaagaagggattttttctttgatgcagatggctaaaacc
tcagcggctgttaaacagcatgccgaacaaggactgttgtatattagcttattaaccgat
ccgacaaccggtggggtaacagctagttttgcaacggaagccgatattattttagccgaa
cccaaagcggtgattggctttgcgggccggcgcgtgattgaacagacgatgcacgaacag
atcgcaccggatttacaagatgctgaaaccgtcttaaaaaatgggtttattgatcaaatc
gtagcacgtcaggatcaaaaaaaggtacttcatcaattgttgaagttacatgaaagaggg
gctcattattaa

DBGET integrated database retrieval system