KEGG   Lactobacillus sakei: LCA_1486Help
Entry
LCA_1486          CDS       T00299                                 

Definition
(GenBank) Putative acetyl-CoA C-acetyltransferase (acetoacetyl-CoA thiolase)
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lsa  Lactobacillus sakei
Pathway
lsa00071  Fatty acid degradation
lsa00072  Synthesis and degradation of ketone bodies
lsa00280  Valine, leucine and isoleucine degradation
lsa00362  Benzoate degradation
lsa00380  Tryptophan metabolism
lsa00620  Pyruvate metabolism
lsa00630  Glyoxylate and dicarboxylate metabolism
lsa00640  Propanoate metabolism
lsa00650  Butanoate metabolism
lsa00900  Terpenoid backbone biosynthesis
lsa01100  Metabolic pathways
lsa01110  Biosynthesis of secondary metabolites
lsa01120  Microbial metabolism in diverse environments
lsa01130  Biosynthesis of antibiotics
lsa01200  Carbon metabolism
lsa01212  Fatty acid metabolism
lsa02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lsa00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LCA_1486
   00630 Glyoxylate and dicarboxylate metabolism
    LCA_1486
   00640 Propanoate metabolism
    LCA_1486
   00650 Butanoate metabolism
    LCA_1486
  Lipid metabolism
   00071 Fatty acid degradation
    LCA_1486
   00072 Synthesis and degradation of ketone bodies
    LCA_1486
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LCA_1486
   00310 Lysine degradation
    LCA_1486
   00380 Tryptophan metabolism
    LCA_1486
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LCA_1486
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LCA_1486
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LCA_1486
Enzymes [BR:lsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LCA_1486
Exosome [BR:lsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LCA_1486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: CAI55788
UniProt: Q38VJ5
Position
complement(1461522..1462718)
Genome map
AA seq 398 aa AA seqDB search
MKEVVIMSAKRTPIGKFGGQLASLTAVDLGTIAAKAAIQAAGIEADQIDQAIFGNVLQAG
SGQNVARQIALNSGLAQTSVAMTVNEVCGSGLKAIRLAQSAIVMGDADVVLVGGTESMSQ
APYLNKGMRFGSKFGDQTVVDSISSEGLNDAFTDKPMGITAENVAAKYGITRLMQDTFAL
ESHQKAAKATQAGWFDAEIVPVTVQQRRATFEVSQDEGIRPDTTLEAMGKLRPAFQADGT
VTAANASGINDGASAMIVMSKEKAEALGLVYQATLVGYQEVGLDPNYMGYTPVPAIQQLL
AKQDQTVADIDLFEINEAFAASSVAVQNGLALDTAKVNVAGGAVALGHPIGASGTRIMTT
LLHQLKRTNKTTGVASLCIGGGLGIAYEIQLNEAWLND
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagtagtcattatgagtgccaaacgaacaccaattgggaagtttggcgggcaa
ttagctagtttaaccgcagtcgatttggggacaatcgcggctaaagcagcgattcaagca
gctggcattgaagctgaccaaattgatcaagctatttttggcaatgtcttacaagctggt
tcaggacaaaatgttgctcgtcaaatcgcattaaatagcggtttagcacaaacgagcgtt
gcgatgactgtgaatgaagtttgtggttctggtttgaaggccatccgtcttgcacaaagt
gcgattgtgatgggcgatgccgatgtcgttttagttggtgggactgaaagcatgtcacaa
gcaccttatttgaataaagggatgcgttttggcagtaagtttggtgatcaaaccgttgtc
gatagtattagtagtgaaggtttaaatgatgccttcaccgataaaccaatggggattacg
gctgaaaacgtagctgccaaatacggcattacacgtttgatgcaagatacattcgctcta
gaatcacatcaaaaagcggctaaggcaacgcaagctggctggtttgatgctgaaattgtc
cccgtaactgtgcaacaacgacgcgcaaccttcgaagtgagccaagacgaagggattcgc
ccagatacaacgcttgaagcaatgggtaaattacgaccagccttccaagcagacggcacc
gttacagcggccaatgcttcaggaatcaacgatggtgcttcggcaatgatcgtgatgtct
aaagaaaaagcagaagcactcggtcttgtttaccaagcaacactagtcggttatcaagaa
gttggcttggaccctaattacatgggttacacaccagtacctgctatccaacaattgttg
gctaaacaagatcaaacggttgctgatattgatttatttgaaatcaatgaagcttttgca
gcctcaagtgttgccgttcaaaacggattagcgttagacactgccaaagtgaacgttgcc
ggtggtgcggttgctttaggtcacccaatcggtgcttcaggcacacggattatgacaact
ttattgcatcaattgaaacgaacaaacaaaacaactggggtcgcttcattatgtattggc
ggtggtttagggattgcttatgaaatccaactgaacgaggcgtggctaaatgactag

DBGET integrated database retrieval system