KEGG   Litorilituus sediminis: EMK97_00430Help
Entry
EMK97_00430       CDS       T05852                                 

Definition
(GenBank) U32 family peptidase
  KO
K08303  putative protease [EC:3.4.-.-]
Organism
lsd  Litorilituus sediminis
Brite
KEGG Orthology (KO) [BR:lsd00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lsd01002]
    EMK97_00430
Enzymes [BR:lsd01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     EMK97_00430
Peptidases and inhibitors [BR:lsd01002]
 Peptidases of unknown catalytic type
  Family U32
   EMK97_00430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_U32 ERp29_N
Motif
Other DBs
NCBI-ProteinID: QBG34313
UniProt: A0A4P6P0D8
Position
99470..100465
Genome map
AA seq 331 aa AA seqDB search
MELLCPAGNLPALKTAIDNGADAVYIGLKDDTNARHFAGLNFNDGKLAKAADYVHERGKK
LHVAINTFAHADGEERWRKAVDNAVAIGTDALIIADVGVLDYAANKYPDVERHVSVQAST
TNLEAIKFFKNNFDVDRVVLPRVLSVQQVRQLAKSSPVSLEVFAFGSLCIMAEGRCYLSS
YMTGESPNTVGACSPAKYVRWQETEQGLESRLNNVLIDRYQSDENAGYPTLCKGRFEVDN
NVYHALEEPTSLNTLELIPELIAMGIVSVKIEGRQRSPAYVEQVAKTWRMALDRYKQSPE
DFAVEGAWMNTLANLSEGSQTTLGAYHRKWQ
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
gtggagttactttgtcctgcgggtaatttacctgcgctaaaaactgccatagataacggt
gctgatgcggtttatattggcttaaaagatgacactaatgccagacattttgctggcctt
aattttaacgatggtaaacttgccaaagccgcagattacgtacatgagcgcggtaaaaaa
ttgcatgtggcgataaatacttttgctcatgctgatggcgaagagcgctggcgtaaggcg
gttgataatgcggttgccattggtactgacgcattaattattgccgatgttggtgtactt
gattatgccgcgaataagtaccctgatgttgaacgccatgtgtcggtacaagcttcaacc
actaaccttgaagcgataaagttttttaaaaataattttgatgttgatcgtgtggtattg
ccacgggtgctttcagttcagcaggtaagacaattggcaaaatctagccctgtctcttta
gaggtatttgcctttggtagcttatgcattatggctgaggggcgatgttacttatcttct
tatatgacaggtgagtcgcctaatactgtaggcgcgtgttccccagctaaatatgtgcgc
tggcaagagacagagcaagggttagagtcgcgcttaaataatgtcttaattgatcgatac
caaagtgatgaaaatgccggttatccaaccttatgtaaaggtcgttttgaagttgataac
aatgtctatcacgcactagaagagccaaccagcctgaacacgttagagctgattcctgaa
ttaattgctatgggcattgtttcggtaaaaattgaaggcagacagcgaagcccagcttat
gttgaacaagtagcaaaaacgtggcgtatggcacttgatagatataaacaaagccctgaa
gactttgccgtggaaggtgcttggatgaataccttagcaaacttatctgaaggctcacaa
accaccttaggtgcttaccatagaaagtggcaataa

DBGET integrated database retrieval system