KEGG   Litorilituus sediminis: EMK97_00440Help
Entry
EMK97_00440       CDS       T05852                                 

Definition
(GenBank) cupin domain-containing protein
  KO
K18850  50S ribosomal protein L16 3-hydroxylase [EC:1.14.11.47]
Organism
lsd  Litorilituus sediminis
Brite
KEGG Orthology (KO) [BR:lsd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:lsd03009]
    EMK97_00440
Enzymes [BR:lsd01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.47  [50S ribosomal protein L16]-arginine 3-hydroxylase
     EMK97_00440
Ribosome biogenesis [BR:lsd03009]
 Prokaryotic type
  ribosomal protein modification factors
   EMK97_00440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupin_4 Cupin_1 Cupin_8 Cupin_2 JmjC AraC_binding
Motif
Other DBs
NCBI-ProteinID: QBG34315
UniProt: A0A4P6P4S4
Position
101448..102602
Genome map
AA seq 384 aa AA seqDB search
MYVLDLAQLTPQAFLDEYWQKKPVVIRQGFKDFQDPISPDEMAGLAMEEEVQSRLVYKEE
GKWQAKFGPFESYEHLGNENWSLVVQALDNFSEEAAQLIEPFRFIPHWRLDDLMASFATP
GGSVGPHIDNYDVFICQGSGKRRWRVGDRGQHTEFAAHEALLHVEPFEAIIDAELEPGDI
IYIPPGFPHEGITLETSMSFSVGFRANAAVNLLSGFADYLIDNELGGQLLEDPDRKVVEH
SGEVSKADYQSIKAQIQGLLDDERLFASFAGKFLTSAKHELDIMLPEEPFTLEEVSQLLT
SHAFKRLGGLRAFYLANTIEQGICYINGEQVEFSVEIIPAVKLLCDQVTVEPEELTQWSS
NLDFINLMKDLLDQGYWYLAESEA
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgtacgttttagatttagcacagttaacgccgcaagcgtttttagatgaatattggcag
aaaaagcctgtagttattcgccaaggttttaaagattttcaagatccgattagcccagat
gaaatggcgggcttagccatggaagaagaagtgcagtctcgcttagtttataaggaagag
ggcaagtggcaagctaagtttggcccttttgaaagctatgagcatctggggaatgaaaat
tggtctttggtggtacaggcccttgataacttctcagaagaagcggcacagcttattgag
ccatttcgctttattccgcattggcgcttagatgatttaatggcaagctttgcaacccca
ggcggtagtgttggtccacatattgataattatgatgtctttatttgccaaggctcaggt
aaaaggcgatggcgtgtaggggatagaggccaacatactgaatttgctgcccacgaagct
ttgctccatgttgagccttttgaagcgataatcgatgcagaactcgagcctggagatatt
atttatattccccctggatttccacatgagggtattacccttgaaacttcaatgagcttt
tctgttggctttagggctaatgcggcggtgaatttattaagcggttttgctgattatctt
attgataatgagcttggagggcaattacttgaagatcctgatagaaaagttgttgaacac
tcaggtgaagtcagtaaagcagactaccaaagcattaaggcgcaaatacagggcttactt
gatgatgagcgcttatttgcaagctttgccggtaagtttttaacctcggcaaaacatgaa
ttagatattatgttaccagaggagccatttaccttagaagaggttagccagttattaacg
agccatgcgtttaagcgattaggtggtttacgtgctttttatttagcgaataccattgaa
caggggatttgttatattaatggcgaacaagttgagttctctgttgaaatcatacctgcg
gttaaattattgtgtgatcaggtcacggtagagcctgaggaattgactcagtggtcgagc
aatttagatttcatcaatttaatgaaagatttacttgatcaaggttattggtatttagct
gaaagcgaagcttga

DBGET integrated database retrieval system