KEGG   Litorilituus sediminis: EMK97_00485Help
Entry
EMK97_00485       CDS       T05852                                 

Definition
(GenBank) proline racemase
  KO
K01777  proline racemase [EC:5.1.1.4]
Organism
lsd  Litorilituus sediminis
Pathway
lsd00330  Arginine and proline metabolism
lsd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lsd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    EMK97_00485
Enzymes [BR:lsd01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.4  proline racemase
     EMK97_00485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pro_racemase PhzC-PhzF DAP_epimerase DUF3363
Motif
Other DBs
NCBI-ProteinID: QBG34324
UniProt: A0A4P6P0K9
Position
complement(112141..113208)
Genome map
AA seq 355 aa AA seqDB search
MQIRKVNPAKQFEQWQVNTEQESYKTINTLECHTGGEPLRIITSGFPELAGNTILAKRRD
CQENHDDLRRALMFEPRGHADMYGAIITEAERENSHFGAIFIHNEGYSTMCGHAVIALAK
CAVESGVVEQTGQVTEVVIDVPCGQIFAKAFAEGNIITQVTFNCVPSFVLAKEQSVDVDG
IGKVDFDVAFGGAFYAYVDAAKLNLSLEPKNQETLIDYGRKIKAAVMNQMAIEHPVEEDL
SFLYGVIFIDKSPNADVHSRNVCIFADGELDRSPTGSGVSGRIALHVAKEEVALEQAIII
ESILGSQFNVKAIEKLDFAGFDAVIPQVTGDAHICGKAQWLINQADPLKYGFLLR
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattagaaaagtaaaccctgccaagcaatttgaacaatggcaagtaaacactgag
caagaaagttataaaactatcaatacgctggaatgtcacacaggtggcgagcctttacgt
attataaccagtggctttcctgagcttgccggaaacactattttagcaaaacgtagagat
tgtcaggaaaaccatgacgatcttcgccgcgccctgatgtttgaaccacgcggtcatgcc
gatatgtatggcgcgattattactgaagcagaacgagaaaatagccattttggtgctatt
tttatccacaacgaaggctatagcaccatgtgtggccatgcggtaattgccctagcgaag
tgtgctgttgagtcgggtgtggttgagcaaacaggtcaagtaaccgaggttgttattgat
gtaccttgtgggcaaatttttgccaaagcctttgcagaaggtaatattattactcaggta
acctttaactgtgtgccatcttttgttttagcaaaagagcaaagtgttgatgttgatggt
attggcaaggttgattttgatgttgcctttggcggcgcattttacgcctacgttgatgct
gcaaagctcaatttatcactcgagcctaaaaaccaagagaccttaattgattatggccgc
aaaattaaagccgctgtgatgaatcaaatggctattgagcaccctgtagaagaagattta
agctttttatatggggttatttttatcgataaatcacctaatgccgatgttcacagtcgt
aatgtctgtatttttgctgacggtgagctagatagaagccctactggcagtggtgttagt
ggccgcattgctttacacgttgccaaagaagaagtggcgctagagcaagccattattata
gaaagtattttaggtagccaattcaatgttaaagccatcgaaaaacttgactttgcaggc
tttgatgctgtcatccctcaagtcacaggcgatgcgcatatttgtggtaaagcacaatgg
ttaatcaaccaagctgatccactaaaatacggttttttattaagataa

DBGET integrated database retrieval system