KEGG   Litorilituus sediminis: EMK97_00750Help
Entry
EMK97_00750       CDS       T05852                                 

Definition
(GenBank) acyl-CoA dehydrogenase
  KO
K06445  acyl-CoA dehydrogenase [EC:1.3.99.-]
Organism
lsd  Litorilituus sediminis
Pathway
lsd00071  Fatty acid degradation
lsd01100  Metabolic pathways
lsd01212  Fatty acid metabolism
Module
lsd_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:lsd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    EMK97_00750
Enzymes [BR:lsd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With unknown physiological acceptors
    1.3.99.-  
     EMK97_00750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1974 Acyl-CoA_dh_N Acyl-CoA_dh_1 Acyl-CoA_dh_M FUSC
Motif
Other DBs
NCBI-ProteinID: QBG34368
UniProt: A0A4P6P1I7
Position
complement(170541..172970)
Genome map
AA seq 809 aa AA seqDB search
MDIIIWLFFATALTWFMTYARVSLSSYTLSFMALMAIGSFFNVIGFISWLLFAVIALPLN
IESIRKQFISLPLLTIFKKIMPQMSSTEQEALDAGTTWFDADLFRGNPDWKKLHNYPQPR
LSSQEKSFLEGPVEEVCAMVNDWHTTHEIADLSDEVWQFLKDNQFFAMIIKKQYGGLEFS
AYAQSRVLQKLTGVSSVLASTVGVPNSLGPGELLQEYGTKEQQDYYLPRLAQGKEIPCFA
LTSPEAGSDAGAIPDSGIVCYGEFDGKEVLGMRLNWNKRYITLAPIATVLGLAFKLNDPE
HLLGDKEELGITCALIPTDIAGITIGRRHFPLNVPFQNGPTQGKDVFVPLDFIIGGKDMA
GQGWRMLVECLSVGRAITLPSNSAGGIKSAALATGAYCRIRRQFKIPIGKMEGVEEPLAR
LGGNAYLMDAVTTMSTGAIDLGEKPSVISAISKYHLTEKMRTSIIDAMDIHGGKGICMGP
NNYLARGYQGAPIAVTVEGANILTRSMIIYGQGAIRCHPYVLAELAAANNDNPEQAQSDF
DHALFGHIGFSISNISRSLWFSFTGAYCLKAPFTDETKRYYQLLTRFSANLAMLSDIAML
AMGSELKRKERISARLGDILSNLYLATAALKRYNDEGRHQADLPLLQWAVEDCLFNIQHA
IDELLNNLGKPWLARALRLIIFPFGRWLKKPSDLIDHKVAQLLQTHNATRARLGKGQYLT
RDGSNLFGKLEQALEDIINCEGIYQKICLSLKQEPPFYQLDKLAEQALAAKIISKAEAEL
LIKAEQSRLWTINVDDFDSSELVAAKNKM
NT seq 2430 nt NT seq  +upstreamnt  +downstreamnt
gtggatattattatttggctattttttgccacagcattaacttggtttatgacctacgct
agagtttctttatcaagctatacattaagctttatggctctcatggccattggcagcttt
ttcaatgttattggctttatatcttggttgctatttgcggttattgcactgcctctgaac
attgagagtattcgaaagcagtttattagcttacctttattaaccatctttaaaaaaatc
atgccgcaaatgtcatcaaccgagcaagaagcgcttgatgcaggtaccacttggtttgat
gccgacctatttcggggtaatcctgactggaaaaagctacataactaccctcaacctaga
ctaagctcgcaagaaaaaagctttttagaaggcccagtagaagaagtatgtgccatggtc
aatgattggcatactacccatgaaattgccgatttatcagatgaggtatggcagttttta
aaagacaatcaattctttgccatgattatcaaaaaacaatatggtggcctagagttttca
gcgtatgcacagtctcgcgtattacaaaaacttaccggagtaagctctgttttagccagt
acggttggcgtacccaactcattaggccctggtgaattactacaagaatacggcacaaaa
gaacaacaagattattatttaccccgtttagcacaaggtaaagaaatcccctgctttgct
ttaactagcccagaagctggctcagatgccggtgctattcccgatagcggcattgtttgc
tatggcgagttcgatggcaaagaagtattaggcatgcgccttaactggaacaagcgctat
atcacccttgctccgatagctaccgtgctaggtttagcgtttaagttaaatgatcctgag
catttattaggtgataaagaagagttaggtattacctgtgcacttatcccaacagacata
gcgggaatcaccataggtagacgacattttccgttaaacgtaccatttcaaaatggacca
acccaaggaaaagacgtttttgttccgctagattttatcatcggtggtaaagacatggcg
gggcaaggctggcgtatgctcgttgaatgtttatctgttggcagagccatcaccttgcca
tcaaacagtgctggcggcattaaatctgcggcattagcaacaggggcttattgtcgcatt
agacgacaatttaaaatccctattggtaaaatggaaggcgttgaagagccattagcacgc
cttggcggtaatgcttacctaatggatgctgtaacaactatgtcaacaggtgccattgat
ttaggcgagaagccctcagttatatctgccatttcaaaataccatttaactgaaaaaatg
cgcacatccatcattgatgccatggatattcatggtggtaaaggtatttgtatgggaccg
aataattaccttgcgcgcggttatcagggcgcaccaattgctgtgactgttgagggagca
aatattttaacgcggagtatgatcatctacggacaaggcgctataagatgtcacccttat
gtattagccgagttggccgctgccaataacgacaacccagagcaagcacaaagcgatttt
gatcatgccctctttggtcatattggctttagtattagcaacatcagcagaagcttatgg
ttctcttttaccggtgcatactgtctgaaagcaccttttactgacgaaactaaacgttac
tatcagctgctaactcgttttagtgctaacttagctatgctctcagatattgccatgcta
gcaatgggctcagagttaaaacgaaaagagcgtatatcagcaagactaggtgatattctt
agtaacttatacttagccaccgcagcattaaagcgttataacgatgaaggcagacaccaa
gcagatttaccattacttcaatgggctgtagaagattgcctgttcaatattcaacatgct
attgatgagctactgaataatttaggcaaaccttggttagcacgagcattaaggttaatc
atattcccatttggtcgttggttgaaaaaaccaagtgatcttatagatcataaagttgcg
cagttattgcaaacgcataacgcaacaagagctagactaggaaaaggacaataccttacc
cgtgatggcagtaacctttttggtaagctggaacaagcattggaagatattattaattgt
gaaggtatttatcaaaagatctgcttgtcattaaaacaagagccacctttttatcaacta
gataaactagcagagcaagccttagctgcgaaaattatttcaaaagctgaagctgaatta
ctgattaaagcggagcaaagtcgtctatggacaattaatgtcgatgactttgattcgagc
gagcttgtcgcggcaaaaaacaaaatgtaa

DBGET integrated database retrieval system