KEGG   Litorilituus sediminis: EMK97_01010Help
Entry
EMK97_01010       CDS       T05852                                 

Definition
(GenBank) PLP-dependent transferase
Organism
lsd  Litorilituus sediminis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP DegT_DnrJ_EryC1 Aminotran_5 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: QBG34414
UniProt: A0A4P6P0R4
Position
227120..228304
Genome map
AA seq 394 aa AA seqDB search
MRKQQPITELVFDGDNNIDPYGAVVPPVYQSSLFTFDSWESLEQAFADKENSVIYTRGNN
PTVQFVEQKLASLAGGEKAKLFSSGMAAISAGIIHFLAQGDHLITLKNIYGPTATLIRNV
LVAKMGVEVSYVSGECLNEIEQAIKPNTRLIYLESPSSVVFSLQDLEQISALAKKHNIAT
MIDNTWATPIYQKPLALGIDLEVHSCSKYLGGHSDIIAGALIARQSLIKDICLQEYELLG
AKLAPVEASMLLRSLRTLPLRMERHQQSALRVAEFLQQQPQVAKVFYPGLPSFAQASLAR
QQMTGFSGLFSFKLNTDDLAKIKKFFNALILFQKGVSWGGHESLIYAPAISCSVEQTPEH
MQRMGISYSDMRISIGLENAEDLIADLANALAKL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaacaacagccaatcacagagttagtttttgatggtgacaataatattgatccc
tatggcgcagtcgtaccgcctgtttatcaaagttcattatttacttttgatagctgggag
tcattagagcaggcttttgccgataaagaaaatagcgtgatttatacgcgaggaaataat
cctacggtgcaatttgtcgagcaaaaactcgcctcacttgctggtggtgaaaaagctaag
ctgttttcctctggcatggcagcaatatcggcaggcattattcattttttagctcagggc
gatcacttgatcaccttaaaaaatatttacggaccaacagccaccttaatacgcaatgtg
ctcgttgctaaaatgggtgttgaagtaagctatgtatctggtgagtgccttaatgaaatt
gagcaggcaataaagccgaatactcgattgatttatcttgaaagcccatcctctgtggtt
ttctctttacaagatttagaacaaattagcgcgttagcgaaaaaacataatattgccact
atgatagataacacttgggcaacgccaatctatcaaaagcctttggcgttagggattgat
ttagaggtacactcttgctcaaaatatcttggcggccacagtgatatcattgccggggct
ttaattgctcgccagtcgttaattaaagacatttgcttacaagagtacgagttactagga
gctaagcttgcccctgtggaagcaagtatgctgcttagaagtttacgtaccttgcctctg
agaatggaaaggcatcaacaaagcgcgctgcgtgtggctgagtttttacaacaacaaccc
caagttgctaaagtattttatcctggcttgccatcatttgcgcaagcctcgcttgcaagg
caacaaatgacagggtttagtggtttatttagttttaaacttaataccgatgacttagca
aagatcaaaaagttttttaatgccctgatcttatttcaaaagggagttagttggggaggg
catgaaagcctgatatatgcacctgcgattagttgtagtgttgagcagacgcctgagcat
atgcagcgcatgggaatttcgtatagcgatatgagaatatcgattggtctagaaaatgcg
gaagatttaattgccgatttagccaatgccttggctaagctataa

DBGET integrated database retrieval system