KEGG   Litorilituus sediminis: EMK97_01110Help
Entry
EMK97_01110       CDS       T05852                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
lsd  Litorilituus sediminis
Pathway
lsd00670  One carbon pool by folate
lsd01100  Metabolic pathways
lsd01120  Microbial metabolism in diverse environments
lsd01200  Carbon metabolism
Module
lsd_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:lsd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    EMK97_01110
Enzymes [BR:lsd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     EMK97_01110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA CitX
Motif
Other DBs
NCBI-ProteinID: QBG34434
UniProt: A0A4P6P0S3
Position
complement(248829..250493)
Genome map
AA seq 554 aa AA seqDB search
MATDVEIAQQFTPKAINEISDKLGIATEHVHPYGRDVAKIDLDALSQPSQKQGKLILVSA
TTPTPSGEGKTTTTIGLGQAFTQLNESVCLALREPSLGPCLGMKGGATGGGYSQIMPGDK
INLHFTGDFHAITSANNLLSAAIDNHIYQGNALSIDPRQIVWRRVMDMNDRSLRNIVLGL
GGKMQGIPREGGFDITAASEVMAMLCLANNAADLKIRLDRTLIGYTYEGEPVHAKDLNIT
GAMMALLRDALQPNLVQSFEGTPTFVHGGPFANIAHGCNSVIATRMAMHHADWAITEAGF
GFDLGAEKFFDIKCRIADLDPDAVVLVTTVRALKMHGGKDKSDLVDEDLSAVAKGLENLD
KHIESVELFNKHPVVALNRFATDTDAEIALIKARCEEHGVSFAETTHHADGGKGAIELAK
AVMASVEKSKPYQPLYDLDLTVVEKVRRVSRKMYGATDVAFSKQAEKDLKHVEQLGLTHL
PICIAKAPSSLSDDPTLHGRPRDFEVTVSSIQINEGAGFLVVLTGNIMRMPGLPKKPAAN
DIKLLPSGVIEGLE
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggcaactgatgtagaaatcgctcagcaatttacgccaaaagcaattaatgaaatcagc
gataaattaggtattgcaacagaacatgttcacccttatgggcgtgatgttgccaaaatt
gaccttgatgcgcttagtcagcctagtcaaaagcaaggcaaattaattttagtttctgca
acaacaccaacaccttcaggtgaaggtaaaaccacaacaaccattggcctaggtcaagca
tttactcagttaaatgaatccgtttgtttagccttgcgagagccatctttaggcccatgt
ttaggtatgaaaggtggggcaactggcggcggctacagccaaatcatgccgggtgataaa
ataaacttacacttcactggcgatttccacgcgattaccagcgccaataatttactttct
gcagctattgataaccacatttaccaaggtaatgccttaagtattgaccctcgccaaatt
gtttggcgtcgtgtaatggatatgaatgatcgcagcttacgtaacattgttttaggctta
ggcggtaaaatgcaaggtattcctcgtgaaggcggctttgacattaccgcagcctctgaa
gtgatggcgatgctttgtttagccaataacgctgctgatttaaaaattcgtttagataga
accttaattggttacacctatgaaggtgagcctgttcatgccaaagatttaaatattacc
ggtgctatgatggcactacttcgtgatgcactgcaacctaacctagtacaaagcttcgaa
ggtacaccaacctttgtacacggcggaccttttgccaacatcgctcatggttgtaacagt
gttatcgccacaagaatggccatgcatcatgctgattgggcaatcaccgaagcaggtttt
ggttttgatttaggtgcagaaaagttcttcgacattaagtgtcgtattgccgatttagac
cctgatgcggtagtacttgttacaacagtacgtgcgctgaaaatgcacggtggtaaagat
aagtctgatttagtcgatgaagatttaagcgcagtagcgaaaggtttagagaacctagat
aagcacattgaaagcgttgagcttttcaacaagcaccctgtggttgcccttaaccgtttt
gctactgacaccgatgctgaaattgcgctgattaaagcacgctgtgaagagcacggcgta
tcatttgctgaaacaacacaccacgccgatggtggtaaaggtgctatagagctagcgaaa
gcagtaatggcatcagtagagaaaagtaagccttatcaaccgctttatgatttagactta
accgttgttgaaaaggtacgtcgcgtaagccgtaaaatgtacggtgcaaccgatgttgct
ttctcaaaacaagcagaaaaagatcttaaacatgttgaacaattaggattaacacattta
cctatttgtattgccaaggcgcctagctctttatctgatgacccaacgctacacggtcgc
ccacgtgactttgaagtaacggtaagttcaattcaaattaacgaaggtgccggtttctta
gtggtattaactggtaatattatgcgtatgcctggtttaccgaaaaaaccagctgccaat
gacataaaattattaccaagtggtgtaattgaaggtctagaataa

DBGET integrated database retrieval system