KEGG   Litorilituus sediminis: EMK97_01395Help
Entry
EMK97_01395       CDS       T05852                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
lsd  Litorilituus sediminis
Pathway
lsd00480  Glutathione metabolism
lsd00590  Arachidonic acid metabolism
lsd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lsd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    EMK97_01395
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    EMK97_01395
Enzymes [BR:lsd01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     EMK97_01395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: QBG34485
UniProt: A0A4P6P581
Position
complement(307727..308206)
Genome map
AA seq 159 aa AA seqDB search
MTSIYQFSVNDYKGVEQPLSQYQGKTLLIVNTASKCGFTPQYEGLEKLQQKFHNQGFDVL
AFPCNQFKQQESGSNDEIKAFCDLHFNISFPLFAKIDVNGENEAALYTYLKEQAPGLLGT
KSIKWNFTKFLVNKQGQVIQRYAPLTKPEALEADIKAIL
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgacatcaatttaccaatttagtgttaatgattataaaggtgtagaacaaccgctatct
caataccaaggtaaaaccttgcttattgtcaatactgcgagcaagtgcggctttacccct
caatatgaaggactagaaaagcttcaacaaaaatttcataaccaaggatttgacgtttta
gcctttccatgcaatcagttcaaacaacaagaaagcggcagcaatgatgaaatcaaagcc
ttttgtgacttgcactttaacatcagtttcccgctatttgctaagattgatgtcaatggt
gaaaacgaagctgcactttatacttatttaaaagaacaagcaccaggcttattagggaca
aaatctatcaaatggaatttcactaagtttctagtgaacaaacaaggtcaagtgattcaa
cgctatgcgcctctaaccaagccagaagcacttgaagcagatataaaagcaatactctaa

DBGET integrated database retrieval system