KEGG   Litorilituus sediminis: EMK97_06990Help
Entry
EMK97_06990       CDS       T05852                                 

Gene name
oadA
Definition
(GenBank) oxaloacetate decarboxylase subunit alpha
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
lsd  Litorilituus sediminis
Pathway
lsd00620  Pyruvate metabolism
lsd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lsd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EMK97_06990 (oadA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lsd02000]
    EMK97_06990 (oadA)
Enzymes [BR:lsd01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     EMK97_06990 (oadA)
Transporters [BR:lsd02000]
 Other transporters
  Primary active transporters [TC:3]
   EMK97_06990 (oadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 RnfC_N PTS_EIIA_1 GCV_H
Motif
Other DBs
NCBI-ProteinID: QBG35481
UniProt: A0A4P6P2I0
Position
complement(1567443..1569230)
Genome map
AA seq 595 aa AA seqDB search
MSKPLGITEVVLRDGHQSLLATRLRLEDMLPIAKTLDEVGYWSIESWGGATFDSCIRYLG
EDPWHRIRELKKAMPNTKQQMLFRGQNILGYRHYADDVVEKFVERAHVNGIDVFRIFDAM
NDVRNLQTSIKAAVKVGAHAQGTLSYTESPVHTLEGWLTMAKQLEDMGAHSLCIKDMSGL
LKPYDAQELISQLKETVSLPVALHCHATTGLSVATQMKAIDSDVDVIDTSISSMSMTYGH
SPTETIASIVEGTERATGLNVDKLAEVAAYFRDVREKYAQFEGSLKGIDARILSAQVPGG
MLTNMENQLKEQGAADKFDEVLTEIPKVRKDLGYIPLVTPTSQIVGTQAVLNVLTGERYK
SITKETSGVLKGEYGATAAPVNADLQNRVLDGNDVITCRPADLLDPEVDKLSSELQELAS
EKNITLADDVIDDVLTYALFPQIGLKFLENRNNPEAFEPVPTKQAAVKTSEPASKASASA
TAPESYAVSVDGKVYDVVVAPGGSIESVSVPVGDEAIKQSASISAEETLNAPLAGNIFKV
LVSEGDHVEAGDVVIIMEAMKMETEVRASTSGQIVSLYTKEGDSVAVGDALLGFS
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaccattaggaattactgaagttgtattaagagacgggcaccaatcgttgctt
gcaactaggttgagacttgaagatatgttgccaattgccaaaacactggacgaagtgggc
tactggtcaattgaatcttgggggggagcaacgtttgattcttgtattcgttatttgggt
gaagatccttggcaccgtatccgcgaattaaaaaaggctatgccaaatactaagcaacaa
atgctgtttcgtggtcaaaatattttaggttaccgtcactatgctgatgatgtggtagaa
aagtttgttgagcgcgctcatgtaaatggtattgatgttttccgtatttttgatgccatg
aatgatgtacgtaatttgcaaacatcgattaaagccgcagtaaaagtaggtgctcatgca
caagggacgttaagttacactgaaagtcctgtgcatactttagaaggctggctaactatg
gctaagcagcttgaagatatgggcgcacactctctatgtatcaaagatatgtctggtttg
ttaaagccttatgatgcgcaagagttgattagtcaattaaaagaaacggtgtcattaccg
gttgctttacattgtcatgcaacaacaggcttaagtgttgctacgcaaatgaaagccatt
gatagtgacgttgatgttattgatacctcaatttcttctatgagtatgacttatggtcat
tcacctaccgaaaccatagcttcaattgttgaaggtacagaacgtgctacgggtttgaat
gttgataaacttgctgaggttgccgcttattttcgtgatgttagagaaaagtatgcacag
tttgaaggcagcttaaaaggtattgatgcgcgaattttaagtgcgcaagttcctggcggc
atgttaactaacatggaaaaccaattaaaagaacaaggtgctgctgataagttcgatgaa
gtgctgactgaaattccgaaagtgagaaaagatttaggttacatcccgctggtgacacca
acctcgcaaatagtcggtacgcaggcggtgttaaatgtactaacaggtgagcgttataag
tctattaccaaagaaacctcaggtgtattaaaaggcgaatacggcgccactgcagcacca
gtgaatgcagatttacaaaacagagtgcttgatggtaatgacgtcattacttgtcgccct
gctgacttacttgatccagaagtggataagctatcaagtgaactacaagagctagcgtca
gaaaagaatattactttagctgatgatgttattgatgacgtattaacttatgcactgttc
ccgcaaataggcttgaagttcttagagaatagaaataacccagaagcgtttgagccagtg
ccaacaaaacaagcagcagttaaaactagtgagccagcgtctaaagcgtctgcatcagct
actgcgccagaaagttatgccgttagtgttgatggtaaagtatacgatgttgtcgttgct
cctggcggctctattgagtcggttagtgtccctgttggtgatgaagcaattaaacagtca
gcttctatttcggcagaagaaacattaaacgcgccacttgccggtaatatctttaaagtg
cttgtgagtgaaggtgatcatgttgaagcgggtgacgttgtcatcattatggaagcgatg
aaaatggaaacagaagtgcgcgcctcaacgtcaggtcagattgtatccttatacaccaaa
gaaggcgactcggttgctgttggtgatgccttgctaggcttttcatag

DBGET integrated database retrieval system