KEGG   Litorilituus sediminis: EMK97_09440Help
Entry
EMK97_09440       CDS       T05852                                 

Gene name
pckA
Definition
(GenBank) phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
lsd  Litorilituus sediminis
Pathway
lsd00010  Glycolysis / Gluconeogenesis
lsd00020  Citrate cycle (TCA cycle)
lsd00620  Pyruvate metabolism
lsd01100  Metabolic pathways
lsd01110  Biosynthesis of secondary metabolites
lsd01120  Microbial metabolism in diverse environments
lsd01130  Biosynthesis of antibiotics
lsd01200  Carbon metabolism
Module
lsd_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lsd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EMK97_09440 (pckA)
   00020 Citrate cycle (TCA cycle)
    EMK97_09440 (pckA)
   00620 Pyruvate metabolism
    EMK97_09440 (pckA)
Enzymes [BR:lsd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     EMK97_09440 (pckA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33
Motif
Other DBs
NCBI-ProteinID: QBG35921
Position
2110120..2111730
Genome map
AA seq 536 aa AA seqDB search
MTALENSIDLSQYGITDVSDVVYNPSYELLFAEETRADLEGFDKGVVTELGAVNVNTGIF
TGRSPKDKYIVRDDSTRDTVWWSDQGKNDNKPMTPETWDHLKGLVTKQLSGQRLFVVDTF
CGADESTRLKVRFITQVAWQAHFVKNMFIRPTEEELKTYQPDFVVMNGAKTVNDKWQEQG
LNSENFVAFNLTEKIQLIGGTWYGGEMKKGMFSMMNYYLPLQGIASMHCSANVGKDGDTA
IFFGLSGTGKTTLSTDPKRQLIGDDEHGWDDNGVFNFEGGCYAKTIKLSKENEPDIYNAI
RRDALLENVTVDADGKIDFDDNSRTENTRVSYPIHHIDNIVKPVSRAGHAKKVIFLTADA
FGVLPPVSKLTPEQTEYYFLSGFTAKLAGTERGITEPTPTFSSCFGAAFLSLHPTQYAEV
LQKRMEAAGAEAYLVNTGWNGTGKRISIKATRAIIDAILDGSIDDAETTVIPMFNLAVPN
SVAGVEGDILDPRNTYEDTSEWHNKAVDLANRFVNNFEKFTDTENGKSLVAAGPQL
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccttagaaaactcaattgatttgtcacaatacggcattactgatgtaagcgat
gttgtttacaatccatcttatgagttactttttgctgaagaaactagagctgatttagaa
ggtttcgataaaggcgttgtcactgaactaggtgctgttaacgttaacacaggcattttt
actggccgctctccaaaagataaatacattgttcgtgatgattcaacacgtgatactgtg
tggtggtctgatcaaggtaaaaacgacaacaaacctatgacacctgaaacttgggatcat
ttaaaaggtttagtgacgaagcaattaagtggtcaacgtttatttgtggttgatactttc
tgtggtgctgacgagtcgacacgtttaaaagtacgttttattacccaagtagcatggcaa
gcacactttgttaagaacatgtttatccgtccaacagaagaagagcttaaaacataccag
cctgactttgttgtgatgaatggcgcaaaaacagttaacgataagtggcaagaacaaggt
ttaaactctgaaaactttgttgcctttaacttaactgaaaaaattcaattaattggtggt
acttggtacggcggtgagatgaaaaaaggtatgttctctatgatgaactactacttacca
ctgcaaggtatcgcttctatgcactgtagtgctaacgttggtaaagatggcgataccgct
attttcttcggtttatctggtacaggtaaaactacgctgtcaaccgatccaaaacgtcaa
ctaattggtgacgacgagcacggttgggatgacaacggcgtatttaactttgaaggtggt
tgttacgcgaaaacaatcaagctgagcaaagaaaacgaacctgatatctacaatgctatc
cgtcgcgatgccttattagaaaacgtaacggttgatgctgatggcaaaatcgattttgat
gataactctcgcactgaaaacacccgtgtttcatacccaattcatcatattgataacatt
gttaagccagtatctcgtgccggccacgcaaagaaagttattttcttaaccgctgatgcc
tttggtgtgttaccgccagtttctaagctaacacctgagcaaactgagtactacttctta
tcaggctttactgctaagcttgctggtactgagcgtggtattactgagccaacaccaacc
ttctctagctgttttggtgcggcattcttaagcttacacccaacacagtacgctgaagtt
ttacaaaaacgtatggaagctgctggtgcagaagcttacttagtaaacacaggttggaac
ggtactggtaagcgtatttctattaaagcaactcgtgccattattgatgctatcttagat
ggttcaattgatgatgcagaaactactgttatccctatgtttaacctagcagtaccaaac
agtgtcgcaggtgttgaaggtgacattttagaccctcgtaatacatacgaagatacaagt
gaatggcataacaaagcggttgatttagcaaaccgtttcgtgaacaactttgagaagttc
actgatacagaaaatggtaaatcattagttgcagcagggccgcagctgtaa

DBGET integrated database retrieval system