KEGG   Litorilituus sediminis: EMK97_10040Help
Entry
EMK97_10040       CDS       T05852                                 

Definition
(GenBank) DUF2726 domain-containing protein
Organism
lsd  Litorilituus sediminis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2726
Motif
Other DBs
NCBI-ProteinID: QBG36024
UniProt: A0A4P6P3Z7
Position
complement(2253127..2253807)
Genome map
AA seq 226 aa AA seqDB search
MEFILFALISLVVIVAVLASRLNDNSFPFPFDSKATIFTPAEKNFQNLVEQAIGSNYRVL
NRVKLSDIVTIRNGVSSRASQSAATNAENKYLDFVICERSSMKLLGAIDLVDTQGKGYKV
KKDWFVSGALEAASIPHLRIKVKANYTLDEIRACISSRLLAGHALNRAPQPKVKGRVIPA
PLVRARNKNTSTNNTGTNVGALSATAAKAQLGHLDSGLSNPAALPH
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggaatttattttatttgctctaattagtttggttgttattgttgcggtactggcaagt
cgtttaaatgacaatagtttcccgtttccttttgatagcaaagcaaccatttttactcct
gccgaaaagaactttcaaaacttggttgaacaggccataggttcaaattatcgcgtgtta
aatcgcgtaaaactatcagatattgtcactattcgtaatggtgtttctagccgagctagc
caaagcgcagcaactaatgccgaaaacaaatatttagattttgttatttgtgagcgcagt
tcaatgaagcttttaggagcaattgatttggttgatacccaagggaaaggctacaaggtt
aagaaagactggtttgttagtggcgctttagaagcggcatctattccacatttacgtatt
aaagtgaaagcaaattacaccttagatgaaattagagcctgtattagcagtagattgtta
gctggtcatgctttaaatagagcgccgcagcctaaagttaaaggccgtgttattcctgcg
ccgttagtaagagcgagaaataagaatacgagcacaaacaataccggcacaaacgtaggt
gctttatcagcaactgcggcaaaagcgcaacttggtcatttagactcaggcctaagcaat
ccagcagccttgccgcactaa

DBGET integrated database retrieval system