KEGG   Litorilituus sediminis: EMK97_10055Help
Entry
EMK97_10055       CDS       T05852                                 

Definition
(GenBank) AraC family transcriptional regulator
Organism
lsd  Litorilituus sediminis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_AraC HTH_18 DJ-1_PfpI Rab5-bind
Motif
Other DBs
NCBI-ProteinID: QBG36027
UniProt: A0A4P6P942
Position
complement(2255508..2256560)
Genome map
AA seq 350 aa AA seqDB search
MARSVLLECFVSYRIHNESQLRVSLAIYQHVLSTSLTLPVEMLLAGEAYARRYDKATSGL
VTQFVSNDEAIIKARSGINLLADVILSDLKEDYFPDIIIVPSLWRNPRPVLRKQQALIAW
LKRCWQQGSTLIGVGTGVCFLAESGLLDNHPATTHWHYVEQFQRDYPQVELKPDFFITQS
DRIYCAASLNALADIIVHIIEQTYGRAAAQNVQRNFSHEIRKPYEEQRYLEGAVDRHADE
LISQIQFWLRTNLDTELSLEQVAQQFGLSQRSFTRRFKAATGVRATQYWQTLRIDMAKDL
LASSNLSIQEIADQVGYQDQGHLTRLFKKQLNLTPKAYRAMVRKKLFSQE
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggccagaagtgtccttttggagtgttttgtgtcatatagaattcataatgaaagccaa
ttgcgggtgagtttagctatatatcaacatgtgctctcgacaagcttaaccctccctgta
gagatgttattggcgggtgaagcctatgcccggcgttatgataaagcaaccagcggctta
gttacccagtttgtcagtaatgatgaagccattatcaaagcacgctcaggcatcaattta
cttgctgatgttatcttgtcagatcttaaagaagactatttccctgatattattattgtg
cctagcttatggcgtaatccaagacctgtgctacgcaagcagcaagcacttattgcttgg
ctgaaaaggtgttggcaacaaggctctaccttgattggcgttggtactggtgtttgtttt
cttgccgagtcgggcttattagataatcaccctgcgacaactcattggcattatgttgag
caatttcaacgtgattacccgcaagtagaactcaagcctgatttttttattactcagtca
gatcgcatttactgtgcggccagcttaaatgcgcttgctgatattattgttcacattatt
gagcaaacctatggtcgcgctgcggcacaaaatgtacaacgtaacttttcgcatgaaatt
cgtaaaccttatgaggagcaaaggtaccttgaaggtgctgtggataggcatgcagatgag
ttgatttcgcaaattcaattttggttaagaacaaacctagataccgagcttagtttggag
caagttgctcagcaatttggtttaagtcagcgctcgtttacacggcgttttaaagcggca
acaggcgttagagcaactcaatattggcaaacattacgtattgatatggcgaaagattta
ctcgcctccagtaatttatctatccaagaaattgccgatcaggttggttatcaagatcaa
gggcacttaacacggctatttaaaaagcaattaaatttaacgccaaaagcttatcgtgcc
atggtgcgaaaaaagctctttagtcaggaatag

DBGET integrated database retrieval system