KEGG   Litorilituus sediminis: EMK97_10060Help
Entry
EMK97_10060       CDS       T05852                                 

Definition
(GenBank) beta-ketoacyl synthase
  KO
K18473  acetoacetyl-[acyl-carrier protein] synthase [EC:2.3.1.180]
Organism
lsd  Litorilituus sediminis
Pathway
lsd00061  Fatty acid biosynthesis
lsd01100  Metabolic pathways
lsd01212  Fatty acid metabolism
Module
lsd_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:lsd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    EMK97_10060
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:lsd01004]
    EMK97_10060
Enzymes [BR:lsd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.180  beta-ketoacyl-[acyl-carrier-protein] synthase III
     EMK97_10060
Lipid biosynthesis proteins [BR:lsd01004]
 Fatty acid synthase
  Component type
   EMK97_10060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C KAsynt_C_assoc ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: QBG36028
UniProt: A0A4P6P505
Position
2256660..2258555
Genome map
AA seq 631 aa AA seqDB search
MTALPLVIGMGGINAAGRTSFHQGFRRIVIDKLNAQARQETFVGLASLMNLISSENGKLV
DQQGNVIEAAEVEAKFGQQILDGTLIRKIEKNHFDPDATHWHQKMKISPRDKNISFELRK
KELPHPLPSAWVVTELDNGRVSVEIPEELTVSHDAYRDNPIKAAGQMPTGFKPESLYNSR
YQPRGLQATIFAATDAIRSTGIEWDTILDKISPDQVGTYSASVAGQMQDEGLGGMLKSRL
AGSRVSTKQLALGLNTMSTDFINAYVTGNVGTTFSSSGACATFLYNLRAAVQDMQAGRIR
VAVVGSAEAPITPEIVEGFGNMSALANEEGLKKLDGNGIADHRRTSRPFGNNCGFTIGEG
AQFVVLMDDALAVEMGAKVLASVADVFVNADGYKKSITAPGPGNYITMAKSVALAEKVLG
KEALQERSFILAHGSSTPQNRVTESLIYHKLATSFDIHNWPVAAPKAYVGHTIGPASGDQ
MAMALGIFSDNIMPGVTTIDKVADDVHNERLNIATEHWNCPDMDVAFINSKGFGGNNATA
TVFSAKVSLAMMAKRHGEQAMKQYYDKLATVELAQQAYRDKANAGQFDIIYKFGEGLLDE
EAIEINADELTFNEFKHTIKLPSENPFDDMV
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgacagctttacctttagtcattggcatgggcggcattaatgctgcaggacgaacttct
tttcatcaaggctttcgtcgcattgttattgataaactaaacgcacaagcacgacaagaa
acctttgtcggcttagcaagtttaatgaacttaatttcaagtgaaaatggtaagttggtt
gatcagcaaggtaatgttatcgaagcagctgaagttgaagctaagtttggtcagcaaatt
ttagacggcacactgattagaaaaattgagaaaaatcattttgatcctgatgcaacacat
tggcatcaaaaaatgaaaattagcccgcgtgataaaaacatcagtttcgaattacgcaaa
aaagagctacctcatccactcccttctgcttgggtggtaactgaattagacaacggtcgc
gtgagtgtcgaaattcctgaggaactaacggtttcacatgatgcctatcgcgataaccca
attaaagccgcagggcaaatgccaacaggctttaaaccagaaagcttatacaacagtcgc
taccaaccacgtggcttacaggcaacaatttttgccgcgactgatgcaattcgctcaacg
ggtattgaatgggatactattttagataaaatcagcccagatcaagttggtacttactct
gcttctgtagctggtcaaatgcaagacgaaggtttaggtggcatgttaaaaagtcgcctt
gctggctctcgtgttagcactaagcaattagccttaggcttaaacaccatgtcaaccgac
tttatcaatgcttatgttaccggtaatgttggcacaaccttctcatcatctggtgcttgt
gcaaccttcctttataacttgcgcgccgcagtacaagatatgcaggctggccgtatccgc
gtggctgtagtcggcagcgctgaagcacctattaccccagaaattgttgaaggttttggt
aatatgagcgcccttgctaacgaggaaggcttaaagaaattagatggcaacggcatagcg
gatcatcgccgtactagccgcccatttggcaataactgtggctttaccataggtgaaggt
gcgcaatttgttgttttaatggatgatgcgctagcagttgaaatgggtgctaaagtattg
gcttctgttgctgatgtctttgtcaatgctgatggctataaaaaatctatcacagcgccg
ggccctggtaactacattactatggcaaagtctgttgctttagctgaaaaagtactcggt
aaagaagcgctacaagaacgaagctttattctggctcatggctcaagtacgccgcaaaac
cgtgtcactgaatcacttatttatcataagttagctaccagctttgatatccataactgg
ccagttgcagcacctaaagcgtacgttggtcacaccataggtcctgcaagtggcgatcaa
atggcgatggcactaggtatctttagcgataacattatgccgggcgtaaccaccatagat
aaagtggcagatgatgttcacaacgaacgccttaatatcgcaactgagcactggaactgt
cctgatatggatgttgcttttatcaactcaaaaggctttggtggtaacaatgccacagca
acggtattttctgccaaagtaagccttgccatgatggcaaaaagacatggcgaacaagcg
atgaagcaatactatgacaaattggcaacggttgaactagcacagcaagcctatcgcgat
aaagccaatgccggtcaatttgatattatctacaagtttggtgaaggtttacttgatgaa
gaagccattgaaatcaatgctgatgaactaacatttaatgagtttaaacataccattaaa
ttaccaagtgaaaacccttttgatgatatggtgtaa

DBGET integrated database retrieval system