KEGG   Litorilituus sediminis: EMK97_10160Help
Entry
EMK97_10160       CDS       T05852                                 

Definition
(GenBank) alpha-glucosidase
  KO
K03931  putative isomerase
Organism
lsd  Litorilituus sediminis
Brite
KEGG Orthology (KO) [BR:lsd00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    EMK97_10160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trehalase Glyco_hydro_63 Bac_rhamnosid6H DUF1823
Motif
Other DBs
NCBI-ProteinID: QBG36045
UniProt: A0A4P6P951
Position
complement(2280928..2283402)
Genome map
AA seq 824 aa AA seqDB search
MTKTISRATQIFTSFLLTSLLTSQALSASGAEKSPATLSLFEPTYRNVIDRQGTPQSYKS
YDKYHNQQFNPFFDLGAWHGFLLPKEEQDYASFTGPMVIAQEYGLFIARKLEQLAITDVV
SKKVYRFADAKVNNYTRPGALIQHYEFSDIKVELSLHFVNQRSALVKTEIVNKTKQSKKL
QLAWHGQLLENWSPDKKIKAQFDNWQVALTAQSNTVEFRFPQLRSTWHMMTSNSSAYQIQ
RSIKSDTKLNQELSQYQSETSVTLAPAAKLAIFTSHSYVHSENEMAQVTEQLAEIFTEPN
QYILASQQRWQNYLHKGLKADNTAKEQHIALKAIETLNGNWRSPAGAIQHNMVSPSVTAR
WFNGAWAWDTWKHAYAMASFNPEIAKDNIRAMFDYQILADDSLRAQDAGMVIDAIFYNKD
SARGGDGGNWNERNSKPPLASWAVWQVYQETGDLAFIEAMYPKLVAYHLWWYRNRDHNGN
GLVEYGATKHRLHNNAQEQITFSVSYHQQPTLNLSACKQGKPWHYQCAGMSSYQQVLDLG
GYIELDIAAQHAAGWESGMDNAARFGFISDEQLQAYANKHYQGDLDKSRADWQVNFFANK
GDKGQLLGYSINQESVELNSYLAQEKHLLAKMALVLDKTKQAQTFTEQAKLLAQQINQCF
FDEKTGFYYDRKIFDNQESSSAHCAGELLINRGRGPEGWSPLFAGIATAEQAKRVVQIMM
SEQEFNTLVPLGTASLTNPAYDGDIYWRGRVWLDQVYFGLVALKNYGYDAQAKQLMNKLL
NNAQGLAEQSSIRENYHPETGAEQGATNFSWSAAHLYMLYRELQ
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaactatcagtagagctactcagatttttacttcatttttacttacttcgctg
ttaactagccaagcgttatcagcatctggagcagaaaagtcacctgctactttatcatta
tttgaaccaacataccgtaatgttatcgatcgtcaaggaacaccacaaagttataaatca
tatgataaatatcataaccaacaatttaatcctttctttgatttaggtgcttggcacggc
tttttattaccgaaagaagagcaggattatgcgagctttaccggccctatggttattgcc
caagagtatgggctgtttattgccagaaagcttgaacagttagcaattaccgatgtggtc
agtaaaaaagtctatcgttttgctgatgctaaggtaaataattacacgaggccgggggcg
ttaattcagcattatgaatttagcgatattaaggttgagctgagtttgcattttgttaat
cagcgtagtgccttagtgaagactgaaatcgtgaataaaactaagcaaagtaaaaaattg
caattagcttggcatggacaattactagaaaactggtcacctgacaagaaaataaaagct
cagtttgataattggcaggtagcgttaacggcacagtcaaacacggtggaatttcgtttt
ccacagctgcgctccacttggcatatgatgaccagcaatagctcagcttatcaaatacaa
agatcgatcaagtcagacactaagcttaaccaagaattatcacagtaccaaagtgagacg
tcggtaacactagcgccagctgctaagttggcaattttcactagccatagctatgtgcat
agtgaaaatgaaatggcgcaagttactgagcaattagcagaaatatttaccgagcctaac
cagtatattttggcaagccagcaaaggtggcagaattatttacataaaggcttaaaggct
gataatacagcgaaagagcagcatattgctttaaaggcaattgaaaccctcaatggtaac
tggcgcagcccagcaggagcaattcaacataatatggtttctccttcggttacagcgcgt
tggtttaatggtgcatgggcttgggatacctggaaacatgcttatgcaatggcaagcttt
aaccctgaaatcgcgaaagacaatattcgcgctatgtttgattatcaaatattggctgat
gacagtttacgagcacaagatgcaggcatggtcattgatgccatcttttataataaagat
agcgctagaggcggtgatggcggtaattggaatgaaagaaatagcaagccacctttggca
agttgggcagtgtggcaggtttatcaagaaaccggtgatttagcttttattgaagcaatg
tatccaaagcttgtggcttatcatttgtggtggtatcgcaaccgtgatcataacggcaat
ggcttagtagagtacggtgcaactaaacacaggttacataataatgcccaagagcagata
accttttcagtgagttatcatcaacagccgacacttaacttatctgcatgtaagcaaggt
aagccgtggcattatcaatgtgcaggcatgtcgagctatcaacaggttcttgatttaggc
ggctatatcgaattagatattgccgcacaacacgccgcaggttgggaatctggtatggat
aacgctgcgcgttttggttttatcagcgatgaacagctacaagcctatgctaataaacat
tatcaaggggatcttgataaatctcgtgctgattggcaagttaacttttttgccaataaa
ggtgataaaggtcagctactcggctattcaatcaatcaagaatctgtggaattaaatagt
tatttagctcaagagaaacacttgttggcaaaaatggcgttagtgttagataaaacaaaa
caagcacaaacatttactgagcaggctaagctattagcacagcaaattaaccagtgcttt
tttgatgaaaaaactggcttttactacgacagaaaaatattcgataaccaagaaagtagc
tctgctcactgtgcgggggagctattaataaatcgcggtcgaggccctgaaggttggagt
ccgttatttgccggtatagccacagctgagcaggccaaacgtgtagtgcagataatgatg
tcagagcaggagtttaataccttagtacctttaggcacggcgtcattaactaacccagct
tatgacggtgatatttattggcgtggtcgggtttggttagatcaagtgtattttggttta
gtggcactaaaaaattacggctatgatgctcaagccaaacaacttatgaataagttatta
aataacgcacagggtttagcagagcaaagtagcattagggaaaactatcacccagaaaca
ggggcagagcaaggggcaactaattttagttggagtgccgcgcacttatatatgctttat
cgtgaattgcagtaa

DBGET integrated database retrieval system