KEGG   Litorilituus sediminis: EMK97_10260Help
Entry
EMK97_10260       CDS       T05852                                 

Definition
(GenBank) TIGR02281 family clan AA aspartic protease
  KO
K06985  aspartyl protease family protein
Organism
lsd  Litorilituus sediminis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: gag-asp_proteas Asp_protease_2 RVP
Motif
Other DBs
NCBI-ProteinID: QBG36063
UniProt: A0A4P6P3X9
Position
2307523..2308041
Genome map
AA seq 172 aa AA seqDB search
MTEDDPTNKMAKIFVWLAWLIALGLLMFFFEDVLDKQYNPNAQPEMRLTSQGKAEVTLVQ
NRHGHYVTNGTINEMPVTFLLDTGATELSIPAHIADNLGLQASGSYRVQTANGSITVYKT
LVEQLSLGNIILYNVAAHINPAMQSDQILLGMSALKRVEFRQTGKQLILREQ
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagatgacccaacaaacaaaatggcaaaaatatttgtttggctagcttggcta
attgcccttggcttattaatgttcttctttgaggatgtactcgacaaacaatataacccc
aatgcccagcctgaaatgcgcttaacgagtcaaggcaaagccgaagtgactttagtacaa
aataggcacggtcattatgttaccaatggcactattaacgagatgccagtcacctttttg
cttgataccggcgccacagagttatctattcctgcgcatattgctgataatttagggctg
caagcaagtggcagctatcgcgtgcaaaccgccaatggcagtatcacagtatataaaacc
ttagttgagcaattgagcttaggtaacataatcctttataatgtcgccgctcacatcaac
cctgccatgcaaagtgatcagattctattaggtatgagcgccttaaaaagagtagaattt
cgccaaacaggtaaacaattaatattacgggaacaatag

DBGET integrated database retrieval system